PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EMT33536 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 195aa MW: 22744.5 Da PI: 10.0843 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 82.1 | 3.5e-26 | 9 | 58 | 1 | 50 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 krien+snrqvtf+kRr+g+ KKA E+ vLCdaev v+ifss gkly++ EMT33536 9 KRIENSSNRQVTFAKRRAGLVKKAREIGVLCDAEVGVVIFSSAGKLYDFW 58 79*********************************************995 PP | |||||||
2 | K-box | 60.8 | 5.6e-21 | 71 | 161 | 1 | 88 |
K-box 1 yqkssgksleeakaeslqqelakLkkeienLq...reqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelq 88 yq++sgk l+++k++s + e++++kke++n+q r+ Rh++Ged++sL+ keL +e++L ++ ++ R+k +++++++ ++ ++ e+e++ EMT33536 71 YQTNSGKILWDEKHKSISAEIDRVKKENDNMQielRQCRHMKGEDVNSLQPKELIAIEEALTNGQTNLRDKMMDHWKMHRRNEKMLEEEHK 161 89999999************************999899*********************************88888888888888777765 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 1.1E-38 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 31.441 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 3.27E-31 | 2 | 95 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.68E-38 | 2 | 80 | No hit | No description |
PRINTS | PR00404 | 1.4E-27 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 3.3E-24 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.4E-27 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.4E-27 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 1.3E-12 | 82 | 166 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 10.61 | 84 | 174 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0010093 | Biological Process | specification of floral organ identity | ||||
GO:0048481 | Biological Process | plant ovule development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0005737 | Cellular Component | cytoplasm | ||||
GO:0016021 | Cellular Component | integral component of membrane | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 195 aa Download sequence Send to blast |
MGRGKIEIKR IENSSNRQVT FAKRRAGLVK KAREIGVLCD AEVGVVIFSS AGKLYDFWTP 60 KTTLPRILEK YQTNSGKILW DEKHKSISAE IDRVKKENDN MQIELRQCRH MKGEDVNSLQ 120 PKELIAIEEA LTNGQTNLRD KMMDHWKMHR RNEKMLEEEH KLLALRMVIL EHFLAFFSLE 180 LIILRNCRHA SAFAN |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 1e-18 | 1 | 86 | 1 | 78 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 1e-18 | 1 | 86 | 1 | 78 | Myocyte-specific enhancer factor 2B |
1tqe_R | 1e-18 | 1 | 86 | 1 | 78 | Myocyte-specific enhancer factor 2B |
1tqe_S | 1e-18 | 1 | 86 | 1 | 78 | Myocyte-specific enhancer factor 2B |
6c9l_A | 1e-18 | 1 | 86 | 1 | 78 | Myocyte-specific enhancer factor 2B |
6c9l_B | 1e-18 | 1 | 86 | 1 | 78 | Myocyte-specific enhancer factor 2B |
6c9l_C | 1e-18 | 1 | 86 | 1 | 78 | Myocyte-specific enhancer factor 2B |
6c9l_D | 1e-18 | 1 | 86 | 1 | 78 | Myocyte-specific enhancer factor 2B |
6c9l_E | 1e-18 | 1 | 86 | 1 | 78 | Myocyte-specific enhancer factor 2B |
6c9l_F | 1e-18 | 1 | 86 | 1 | 78 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in the development of floral organs. B-class protein required for normal development of lodicules and stamens (whorls 2 and 3). May function as a heterodimer with MADS16. {ECO:0000269|PubMed:9869408}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00080 | ChIP-seq | Transfer from AT5G20240 | Download |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AM502880 | 0.0 | AM502880.1 Triticum aestivum mRNA for MIKC-type MADS-box transcription factor WM14 (WM14 gene). |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020166620.1 | 1e-115 | MADS-box transcription factor 4-like | ||||
Swissprot | Q40703 | 1e-101 | MADS4_ORYSJ; MADS-box transcription factor 4 | ||||
TrEMBL | N1R523 | 1e-142 | N1R523_AEGTA; MADS-box transcription factor 4 | ||||
STRING | EMT33536 | 1e-143 | (Aegilops tauschii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP3434 | 38 | 77 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G20240.1 | 1e-61 | MIKC_MADS family protein |