![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
Previous version:
v3.0
v4.0
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EMT33037 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 170aa MW: 18822.1 Da PI: 7.5001 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 55.6 | 1.2e-17 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg W++eEde+l + ++++G+g+W+++++ g+ R++k+c++rw +yl EMT33037 14 RGLWSPEEDEKLMNHIAKYGNGCWSSVPKIAGLERCGKSCRLRWINYL 61 788*******************************************97 PP | |||||||
2 | Myb_DNA-binding | 38.5 | 2.7e-12 | 67 | 103 | 1 | 39 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkq 39 rg++++eE++l+++++ lG++ W+ Ia+ ++ gRt+++ EMT33037 67 RGAFSQEEEDLIIHLHSILGNK-WSQIAAQLP-GRTDNE 103 89********************.*********.****96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 8.3E-26 | 9 | 64 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 25.438 | 9 | 65 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 9.36E-28 | 11 | 103 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 3.9E-13 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.7E-16 | 14 | 61 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.30E-11 | 17 | 61 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 7.5E-19 | 65 | 103 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 10.44 | 66 | 123 | IPR017930 | Myb domain |
SMART | SM00717 | 0.0082 | 66 | 121 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 7.2E-11 | 67 | 103 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 3.13E-7 | 69 | 103 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 170 aa Download sequence Send to blast |
MSKRPGGMKK RLKRGLWSPE EDEKLMNHIA KYGNGCWSSV PKIAGLERCG KSCRLRWINY 60 LRPDLKRGAF SQEEEDLIIH LHSILGNKWS QIAAQLPGRT DNEDGNAAGA GADHYGAALD 120 ELKWSDYVFD GGYPQYHQQG QCIYGDSKAA ADAAAGQFDA HGLGINWCLN |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 3e-23 | 12 | 119 | 25 | 124 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. {ECO:0000250}. | |||||
UniProt | Transcription factor that coordinates a small network of downstream target genes required for several aspects of plant growth and development, such as xylem formation and xylem cell differentiation, and lateral root formation (PubMed:22708996). Regulates a specific set of target genes by binding DNA to the AC cis-element 5'-ACCTAC-3' (PubMed:23741471). Functions as a transcriptional regulator of stomatal closure. Plays a role the regulation of stomatal pore size independently of abscisic acid (ABA) (PubMed:16005292). Required for seed coat mucilage deposition during the development of the seed coat epidermis (PubMed:19401413). Involved in the induction of trichome initiation and branching by positively regulating GL1 and GL2. Required for gibberellin (GA) biosynthesis and degradation by positively affecting the expression of the enzymes that convert GA9 into the bioactive GA4, as well as the enzymes involved in the degradation of GA4 (PubMed:28207974). {ECO:0000269|PubMed:16005292, ECO:0000269|PubMed:19401413, ECO:0000269|PubMed:22708996, ECO:0000269|PubMed:23741471, ECO:0000269|PubMed:28207974}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | JF951901 | 1e-173 | JF951901.1 Triticum aestivum clone TaMYB17 R2R3-MYB protein mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020154053.1 | 3e-69 | transcription factor MYB3-like | ||||
Swissprot | Q8LPH6 | 7e-53 | MYB86_ARATH; Transcription factor MYB86 | ||||
Swissprot | Q8VZQ2 | 1e-52 | MYB61_ARATH; Transcription factor MYB61 | ||||
TrEMBL | M8CZ70 | 1e-123 | M8CZ70_AEGTA; Transcription factor MYB86 | ||||
STRING | EMT33037 | 1e-123 | (Aegilops tauschii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP3092 | 33 | 85 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G01680.3 | 2e-53 | myb domain protein 55 |
Publications ? help Back to Top | |||
---|---|---|---|
|