PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT33037
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family MYB
Protein Properties Length: 170aa    MW: 18822.1 Da    PI: 7.5001
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT33037genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.61.2e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg W++eEde+l + ++++G+g+W+++++  g+ R++k+c++rw +yl
         EMT33037 14 RGLWSPEEDEKLMNHIAKYGNGCWSSVPKIAGLERCGKSCRLRWINYL 61
                     788*******************************************97 PP

2Myb_DNA-binding38.52.7e-1267103139
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkq 39 
                      rg++++eE++l+++++  lG++ W+ Ia+ ++ gRt+++
         EMT33037  67 RGAFSQEEEDLIIHLHSILGNK-WSQIAAQLP-GRTDNE 103
                      89********************.*********.****96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.3E-26964IPR009057Homeodomain-like
PROSITE profilePS5129425.438965IPR017930Myb domain
SuperFamilySSF466899.36E-2811103IPR009057Homeodomain-like
SMARTSM007173.9E-131363IPR001005SANT/Myb domain
PfamPF002492.7E-161461IPR001005SANT/Myb domain
CDDcd001671.30E-111761No hitNo description
Gene3DG3DSA:1.10.10.607.5E-1965103IPR009057Homeodomain-like
PROSITE profilePS5129410.4466123IPR017930Myb domain
SMARTSM007170.008266121IPR001005SANT/Myb domain
PfamPF002497.2E-1167103IPR001005SANT/Myb domain
CDDcd001673.13E-769103No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 170 aa     Download sequence    Send to blast
MSKRPGGMKK RLKRGLWSPE EDEKLMNHIA KYGNGCWSSV PKIAGLERCG KSCRLRWINY  60
LRPDLKRGAF SQEEEDLIIH LHSILGNKWS QIAAQLPGRT DNEDGNAAGA GADHYGAALD  120
ELKWSDYVFD GGYPQYHQQG QCIYGDSKAA ADAAAGQFDA HGLGINWCLN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-231211925124MYB TRANSFORMING PROTEIN
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
UniProtTranscription factor that coordinates a small network of downstream target genes required for several aspects of plant growth and development, such as xylem formation and xylem cell differentiation, and lateral root formation (PubMed:22708996). Regulates a specific set of target genes by binding DNA to the AC cis-element 5'-ACCTAC-3' (PubMed:23741471). Functions as a transcriptional regulator of stomatal closure. Plays a role the regulation of stomatal pore size independently of abscisic acid (ABA) (PubMed:16005292). Required for seed coat mucilage deposition during the development of the seed coat epidermis (PubMed:19401413). Involved in the induction of trichome initiation and branching by positively regulating GL1 and GL2. Required for gibberellin (GA) biosynthesis and degradation by positively affecting the expression of the enzymes that convert GA9 into the bioactive GA4, as well as the enzymes involved in the degradation of GA4 (PubMed:28207974). {ECO:0000269|PubMed:16005292, ECO:0000269|PubMed:19401413, ECO:0000269|PubMed:22708996, ECO:0000269|PubMed:23741471, ECO:0000269|PubMed:28207974}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF9519011e-173JF951901.1 Triticum aestivum clone TaMYB17 R2R3-MYB protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020154053.13e-69transcription factor MYB3-like
SwissprotQ8LPH67e-53MYB86_ARATH; Transcription factor MYB86
SwissprotQ8VZQ21e-52MYB61_ARATH; Transcription factor MYB61
TrEMBLM8CZ701e-123M8CZ70_AEGTA; Transcription factor MYB86
STRINGEMT330371e-123(Aegilops tauschii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30923385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01680.32e-53myb domain protein 55
Publications ? help Back to Top
  1. Heyndrickx KS,Vandepoele K
    Systematic identification of functional plant modules through the integration of complementary data sources.
    Plant Physiol., 2012. 159(3): p. 884-901
    [PMID:22589469]
  2. Matías-Hernández L, et al.
    AaMYB1 and its orthologue AtMYB61 affect terpene metabolism and trichome development in Artemisia annua and Arabidopsis thaliana.
    Plant J., 2017. 90(3): p. 520-534
    [PMID:28207974]