PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EMT32403 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 108aa MW: 12247.1 Da PI: 10.1675 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 57 | 4.5e-18 | 15 | 61 | 2 | 48 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 g+WT+eEd++l+ +++q+G g+W++ ++ g+ R++k+c++rw +yl EMT32403 15 GKWTEEEDDILASYIAQHGEGSWRSLPKNAGLLRCGKSCRLRWVNYL 61 89*****************************99************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 3.2E-22 | 5 | 63 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 19.6 | 9 | 65 | IPR017930 | Myb domain |
SMART | SM00717 | 4.6E-12 | 13 | 63 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 6.36E-22 | 15 | 89 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 7.6E-17 | 15 | 61 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.60E-10 | 16 | 61 | No hit | No description |
PROSITE profile | PS50090 | 4.565 | 62 | 100 | IPR017877 | Myb-like domain |
Gene3D | G3DSA:1.10.10.60 | 6.7E-8 | 64 | 88 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 108 aa Download sequence Send to blast |
MGRAPCCQKL GLKQGKWTEE EDDILASYIA QHGEGSWRSL PKNAGLLRCG KSCRLRWVNY 60 LRDGVKRGSF SKEEDDLIVK LHATIGKSTT NIGNNKKYIW IRKPPSKD |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor postulated to regulate the biosynthetic pathway of a flavonoid-derived pigment in certain floral tissues. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020183958.1 | 9e-59 | myb-related protein P-like isoform X2 | ||||
Swissprot | P27898 | 3e-45 | MYBP_MAIZE; Myb-related protein P | ||||
TrEMBL | M8CDZ2 | 5e-74 | M8CDZ2_AEGTA; Myb-related protein P | ||||
STRING | EMT32403 | 8e-75 | (Aegilops tauschii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP116 | 37 | 448 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G62610.1 | 3e-43 | myb domain protein 11 |