PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT30422
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family NAC
Protein Properties Length: 328aa    MW: 36640.1 Da    PI: 9.5759
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT30422genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM167.83.6e-52171441129
       NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvg 101
               lp GfrFhPtdee+++ yL +kv + ++ +  +i+evd++k +P +Lpkk+k +ekewyf++++d+ky+tg r+nratk+gyWkatgkdke+++   +l+g
  EMT30422  17 LPSGFRFHPTDEEIITSYLVPKVLNPTFIA-IAITEVDLNKNDPYELPKKAKMGEKEWYFYCQKDRKYPTGIRTNRATKAGYWKATGKDKEIFHPLPTLIG 116
               699**********************99777.78***************99999******************************************999*** PP

       NAM 102 lkktLvfykgrapkgektdWvmheyrle 129
               +kktLvfykgrap+gekt+Wvmheyrle
  EMT30422 117 MKKTLVFYKGRAPRGEKTNWVMHEYRLE 144
               **************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.62E-5710179IPR003441NAC domain
PROSITE profilePS5100554.47117179IPR003441NAC domain
PfamPF023654.3E-2718143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MADHLQVQQQ HQHQLELPSG FRFHPTDEEI ITSYLVPKVL NPTFIAIAIT EVDLNKNDPY  60
ELPKKAKMGE KEWYFYCQKD RKYPTGIRTN RATKAGYWKA TGKDKEIFHP LPTLIGMKKT  120
LVFYKGRAPR GEKTNWVMHE YRLEISKQPA YGPSTAIAKA AAINASSKKE RVVCKIFHKN  180
IGVKKVVTPS YAMHMPMSTG GEQQHGSLNS CTFPPPMDYD ASLSLAPPLF RSEDSSYQLH  240
AARVGLSMTG SLMLPMVNNH HHEMMGGNPM VSYQQQQMMQ MQMQMGAVQC FMVGVEPGSE  300
SSSKVSGEGV DRLSNNVQGN GAATTIGR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-4741853171NO APICAL MERISTEM PROTEIN
1ut4_B2e-4741853171NO APICAL MERISTEM PROTEIN
1ut7_A2e-4741853171NO APICAL MERISTEM PROTEIN
1ut7_B2e-4741853171NO APICAL MERISTEM PROTEIN
4dul_A2e-4741853171NAC domain-containing protein 19
4dul_B2e-4741853171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtBinds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020179085.10.0NAC domain-containing protein 92-like
SwissprotQ9FK442e-73NAC87_ARATH; NAC domain-containing protein 87
TrEMBLM8CS470.0M8CS47_AEGTA; Protein CUP-SHAPED COTYLEDON 2
STRINGEMT304220.0(Aegilops tauschii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP145237121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18270.12e-71Arabidopsis NAC domain containing protein 87
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]