PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT26625
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family MYB
Protein Properties Length: 295aa    MW: 31539.1 Da    PI: 6.2349
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT26625genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.91.5e-151562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEd++l d++ ++G g+W++ +++ g+ R +k+c++rw +yl
         EMT26625 15 KGLWSPEEDQKLRDYILRHGHGCWSALPAKAGLQRNGKSCRLRWINYL 62
                     678*******************************************97 PP

2Myb_DNA-binding53.74.6e-1769113248
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      g +++eE+e    +++ lG++ W++Iar+++ gRt++++k++w++yl
         EMT26625  69 GMFSPEEEETVMSLHAALGNK-WSRIARHLP-GRTDNEVKNYWNSYL 113
                      569******************.*********.*************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.8191062IPR017930Myb domain
SuperFamilySSF466899.17E-2912109IPR009057Homeodomain-like
SMARTSM007175.3E-111464IPR001005SANT/Myb domain
PfamPF002491.1E-131562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.1E-221669IPR009057Homeodomain-like
CDDcd001673.40E-101862No hitNo description
PROSITE profilePS5129425.12363117IPR017930Myb domain
SMARTSM007176.3E-1467115IPR001005SANT/Myb domain
PfamPF002491.8E-1569113IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-2570116IPR009057Homeodomain-like
CDDcd001679.82E-1271113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MGCKACDKPR PSYRKGLWSP EEDQKLRDYI LRHGHGCWSA LPAKAGLQRN GKSCRLRWIN  60
YLRPGLKHGM FSPEEEETVM SLHAALGNKW SRIARHLPGR TDNEVKNYWN SYLKKRVEGG  120
KEAPGSPAPP AANSAAESDG SQSPSQGEVS TAQERAGRPS NSGSSEPPHE SSSADSSCLT  180
VTEPPACRAH APVAPKVMFA DWLNMDYIGG QVAAAAPGPE AAGVVGAGGG DHRQVMSQGS  240
AQVDGPPGVE DPLHGGFGDN GTCWEFLEQF DSMDQMQAGG GFCDLLSMTE FFGLN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-25111183109B-MYB
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that promotes photomorphogenesis in the light by participating in the transmission of phytochrome A (phyA) signals to downstream responses (PubMed:11581165, PubMed:19482971). Probably acts by activating expression of light-induced genes. In darkness, its degradation prevents the activation of light-induced genes (PubMed:11581165). {ECO:0000269|PubMed:11581165, ECO:0000269|PubMed:19482971}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By hormones or elicitors treatment. By exposure to abiotic stress. {ECO:0000269|PubMed:9839469}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020168350.10.0transcription factor LAF1-like
SwissprotQ9M0K42e-57LAF1_ARATH; Transcription factor LAF1
TrEMBLA0A453P5X60.0A0A453P5X6_AEGTS; Uncharacterized protein
TrEMBLM8BNP80.0M8BNP8_AEGTA; Transcription factor LAF1
STRINGEMT266250.0(Aegilops tauschii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP170737109
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52260.11e-56myb domain protein 19
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]