PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EMT22736 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 217aa MW: 24860.3 Da PI: 10.236 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 60.7 | 3.2e-19 | 21 | 68 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WTt+Ed+ll+d v+q+G g+W+++++ g++R++k+c++rw +yl EMT22736 21 KGPWTTQEDKLLLDHVAQHGEGRWNSVSKLTGLKRSGKSCRLRWVNYL 68 79********************************************97 PP | |||||||
2 | Myb_DNA-binding | 54.4 | 2.8e-17 | 74 | 118 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg++T++E+ +v+++ ++G++ W+tIar ++ gRt++++k++w+++ EMT22736 74 RGKMTPQEESTIVQLHSLWGNR-WSTIARSLP-GRTDNEIKNYWRTH 118 89********************.*********.************87 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 16.568 | 16 | 68 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.72E-29 | 19 | 115 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 9.4E-16 | 20 | 70 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.1E-17 | 21 | 68 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 9.1E-23 | 22 | 75 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.52E-11 | 23 | 68 | No hit | No description |
PROSITE profile | PS51294 | 24.696 | 69 | 123 | IPR017930 | Myb domain |
SMART | SM00717 | 2.0E-15 | 73 | 121 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 5.4E-15 | 74 | 118 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 4.11E-10 | 76 | 118 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 3.0E-23 | 76 | 121 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 217 aa Download sequence Send to blast |
MAEAEGQLAA CWGKQDDEWR KGPWTTQEDK LLLDHVAQHG EGRWNSVSKL TGLKRSGKSC 60 RLRWVNYLRP DLKRGKMTPQ EESTIVQLHS LWGNRWSTIA RSLPGRTDNE IKNYWRTHYK 120 KGKPSKNIER ARARFLMQRR EMQQQQQQKL LLGQGKDVEL PGATVSDDLG GTMERARETE 180 DVFSLVGTDE ALFLPSAYSN IRDKGVLKLV SVLILTV |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 4e-26 | 21 | 117 | 27 | 122 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription repressor of phosphate (Pi) starvation-induced genes. Regulates negatively Pi starvation responses via the repression of gibberellic acid (GA) biosynthesis and signaling. Modulates root architecture, phosphatase activity, and Pi uptake and accumulation. {ECO:0000269|PubMed:19529828}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Slightly induced by salicylic acid (PubMed:16463103). Induced reversibly in response to phosphate (Pi) deficiency but repressed in the presence of Pi, specifically in the leaves. Availability of Pi increases with decreased levels (PubMed:19529828). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:19529828}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK109620 | 1e-118 | AK109620.1 Oryza sativa Japonica Group cDNA clone:002-138-A05, full insert sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020160476.1 | 1e-110 | transcription factor MYB3-like | ||||
Swissprot | Q9C9G7 | 2e-50 | MYB62_ARATH; Transcription factor MYB62 | ||||
TrEMBL | M8CHM0 | 1e-159 | M8CHM0_AEGTA; Myb-related protein 305 | ||||
STRING | EMT22736 | 1e-159 | (Aegilops tauschii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP3243 | 35 | 84 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G13480.1 | 5e-63 | myb domain protein 79 |
Publications ? help Back to Top | |||
---|---|---|---|
|