PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT22284
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family MYB
Protein Properties Length: 345aa    MW: 36813.7 Da    PI: 4.347
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT22284genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.88.8e-171663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT++Ed +l+ +++++G  +W++ +r  g+ R++k+c++rw +yl
         EMT22284 16 RGSWTPQEDMRLIAYIQKHGHANWRALPRQAGLLRCGKSCRLRWINYL 63
                     89******************************99************97 PP

2Myb_DNA-binding51.42.4e-1669114148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+eE+   ++++++lG++ W++Ia++++ gRt++++k+ w+++l
         EMT22284  69 RGNFTAEEEATVIKLHALLGNK-WSKIAACLP-GRTDNEIKNVWNTHL 114
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.1E-22766IPR009057Homeodomain-like
PROSITE profilePS5129414.2111163IPR017930Myb domain
SuperFamilySSF466892.7E-2913110IPR009057Homeodomain-like
SMARTSM007171.4E-121565IPR001005SANT/Myb domain
PfamPF002497.5E-151663IPR001005SANT/Myb domain
CDDcd001674.21E-101863No hitNo description
PROSITE profilePS5129424.39364118IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-2567117IPR009057Homeodomain-like
SMARTSM007173.8E-1468116IPR001005SANT/Myb domain
PfamPF002498.8E-1569114IPR001005SANT/Myb domain
CDDcd001674.21E-1171114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 345 aa     Download sequence    Send to blast
MGRGRAPCCA KVGLNRGSWT PQEDMRLIAY IQKHGHANWR ALPRQAGLLR CGKSCRLRWI  60
NYLRPDLRRG NFTAEEEATV IKLHALLGNK WSKIAACLPG RTDNEIKNVW NTHLKKRASE  120
QKPGVGESKG EAADGDPDTP VPSLSSASSS MTSSEGSNGG AGGQGSNGGA GEQCGTSNDP  180
ETMDVPSPLE LELEPVMDIL DMLADAPTEA LATAAPMPTS SCSSPSLTTG AGGGGGVEEL  240
LELPDIDMDA DIWSIIDDDI ARLQQGDATV PCTTKASQEE EGNEWWLQDL EKELGLWGPT  300
EESQPQAGPH DQIGYPGQLS ETEGDMVMVS SHPQSRSDHE ASNSE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C5e-25141172104C-Myb DNA-Binding Domain
1msf_C5e-25141172104C-Myb DNA-Binding Domain
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that regulates positively genes involved in anthocyanin biosynthesis such as A1. {ECO:0000269|PubMed:7920701}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2486491e-126AK248649.1 Hordeum vulgare subsp. vulgare cDNA clone: FLbaf178a22, mRNA sequence.
GenBankAK3696891e-126AK369689.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2095N02.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020189024.10.0myb-related protein Zm1-like
SwissprotP200241e-112MYB1_MAIZE; Myb-related protein Zm1
TrEMBLM8BK070.0M8BK07_AEGTA; Myb-related protein Zm1
STRINGEMT222840.0(Aegilops tauschii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21543798
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79180.19e-67myb domain protein 63
Publications ? help Back to Top
  1. Franken P,Schrell S,Peterson PA,Saedler H,Wienand U
    Molecular analysis of protein domain function encoded by the myb-homologous maize genes C1, Zm 1 and Zm 38.
    Plant J., 1994. 6(1): p. 21-30
    [PMID:7920701]