PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EMT21769 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 218aa MW: 23684.8 Da PI: 10.3628 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 91.8 | 3.4e-29 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien++ rqvtf+kRrng+lKKA+ELSvLC+ae+a+i+fs +g+lyey+s EMT21769 9 KRIENTTSRQVTFCKRRNGLLKKAYELSVLCEAEIALIVFSARGRLYEYAS 59 79***********************************************86 PP | |||||||
2 | K-box | 67.1 | 6.1e-23 | 84 | 139 | 14 | 69 |
K-box 14 aeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskK 69 ++qqe+akL+ +i++Lq+ +R+l+Ge++++L+lkeL++Le++L+k++ +iR+kK EMT21769 84 DVNSQQESAKLRHQIQSLQNANRNLMGESVGNLTLKELKSLENRLDKGIGRIRAKK 139 5689***************************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 7.3E-41 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 33.179 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 2.22E-31 | 2 | 73 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 4.75E-43 | 2 | 71 | No hit | No description |
PRINTS | PR00404 | 1.6E-31 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 4.8E-25 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.6E-31 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.6E-31 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 8.754 | 84 | 184 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 8.6E-17 | 86 | 139 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009827 | Biological Process | plant-type cell wall modification | ||||
GO:0009860 | Biological Process | pollen tube growth | ||||
GO:0009886 | Biological Process | post-embryonic morphogenesis | ||||
GO:0009909 | Biological Process | regulation of flower development | ||||
GO:0048441 | Biological Process | petal development | ||||
GO:0048443 | Biological Process | stamen development | ||||
GO:0048481 | Biological Process | plant ovule development | ||||
GO:0048507 | Biological Process | meristem development | ||||
GO:0080155 | Biological Process | regulation of double fertilization forming a zygote and endosperm | ||||
GO:0090376 | Biological Process | seed trichome differentiation | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 218 aa Download sequence Send to blast |
MGRGKIEIKR IENTTSRQVT FCKRRNGLLK KAYELSVLCE AEIALIVFSA RGRLYEYASN 60 STRTTIDRYK KASASASGSA PAIDVNSQQE SAKLRHQIQS LQNANRNLMG ESVGNLTLKE 120 LKSLENRLDK GIGRIRAKKV AEAERLALAA PPPSSGSGAE LEVLPTFDAR SYYHHQAVNM 180 LQDAAAASSS SRYSQSSQAA AATTALHLGY QIKGAQLN |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 2e-20 | 1 | 69 | 1 | 69 | MEF2C |
5f28_B | 2e-20 | 1 | 69 | 1 | 69 | MEF2C |
5f28_C | 2e-20 | 1 | 69 | 1 | 69 | MEF2C |
5f28_D | 2e-20 | 1 | 69 | 1 | 69 | MEF2C |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AM502895 | 0.0 | AM502895.1 Triticum aestivum mRNA for MIKC-type MADS-box transcription factor WM27B (WM27B gene). |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020149610.1 | 1e-116 | MADS-box transcription factor 21-like | ||||
Swissprot | Q8RU31 | 8e-87 | MAD21_ORYSJ; MADS-box transcription factor 21 | ||||
TrEMBL | M8BIK4 | 1e-157 | M8BIK4_AEGTA; MADS-box transcription factor 21 | ||||
STRING | EMT21769 | 1e-157 | (Aegilops tauschii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP649 | 37 | 144 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G09960.2 | 2e-66 | MIKC_MADS family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|