PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

EMT20647

Organism

Aegilops tauschii

Taxonomic ID

37682

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops

Family

NAC

Protein Properties

Length: 279aa MW: 31072.4 Da PI: 9.0657

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EMT20647	genome	BGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	181	3.1e-56	5	130	1	128
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvg 101 lppGfrFhPtdeel+++yL +kv++ ++ + ++i++vd++k+ePwdLp+k++ +ekewyfFs rd+ky+tg r+nrat+sgyWk+tgkdke+++ +g+lvg EMT20647 5 LPPGFRFHPTDEELITYYLSRKVSDFSFAT-RAIADVDLNKCEPWDLPSKASMGEKEWYFFSMRDRKYPTGIRTNRATESGYWKTTGKDKEIFH-GGRLVG 103 79***********************999.88***********999999************************************.** PP NAM 102 lkktLvfykgrapkgektdWvmheyrl 128 +kktLvfy grapkgekt+Wvmheyr+ EMT20647 104 MKKTLVFYGGRAPKGEKTSWVMHEYRI 130 ***********************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	6.54E-65	3	151	IPR003441	NAC domain
PROSITE profile	PS51005	60.413	5	151	IPR003441	NAC domain
Pfam	PF02365	2.0E-29	6	130	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0010089	Biological Process	xylem development
GO:0044036	Biological Process	cell wall macromolecule metabolic process
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 279 aa Download sequence Send to blast
MEEGLPPGFR FHPTDEELIT YYLSRKVSDF SFATRAIADV DLNKCEPWDL PSKASMGEKE 60 WYFFSMRDRK YPTGIRTNRA TESGYWKTTG KDKEIFHGGR LVGMKKTLVF YGGRAPKGEK 120 TSWVMHEYRI QNKFPYKPNK EEWVVCRVFK KSQIVKMRHP QDSPDMDSPC NDAHASLGEL 180 GEIDVSSILG SFTPASANAP GDHFGHRIDM GAYMNWLAAA NQGAAAMLPW AAAAAPGLLG 240 TVFSANPAMQ KALAPFAGCS QLPRDVGVKN GTIPWVRIN

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	8e-57	5	152	17	166	NO APICAL MERISTEM PROTEIN
1ut4_B	8e-57	5	152	17	166	NO APICAL MERISTEM PROTEIN
1ut7_A	8e-57	5	152	17	166	NO APICAL MERISTEM PROTEIN
1ut7_B	8e-57	5	152	17	166	NO APICAL MERISTEM PROTEIN
3swm_A	9e-57	5	152	20	169	NAC domain-containing protein 19
3swm_B	9e-57	5	152	20	169	NAC domain-containing protein 19
3swm_C	9e-57	5	152	20	169	NAC domain-containing protein 19
3swm_D	9e-57	5	152	20	169	NAC domain-containing protein 19
3swp_A	9e-57	5	152	20	169	NAC domain-containing protein 19
3swp_B	9e-57	5	152	20	169	NAC domain-containing protein 19
3swp_C	9e-57	5	152	20	169	NAC domain-containing protein 19
3swp_D	9e-57	5	152	20	169	NAC domain-containing protein 19
4dul_A	8e-57	5	152	17	166	NAC domain-containing protein 19
4dul_B	8e-57	5	152	17	166	NAC domain-containing protein 19
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator of STM and KNAT6. Involved in molecular mechanisms regulating shoot apical meristem (SAM) formation during embryogenesis and organ separation. Required for the fusion of septa of gynoecia along the length of the ovaries. Activates the shoot formation in callus in a STM-dependent manner. Controls leaf margin development and required for leaf serration. Involved in axillary meristem initiation and separation of the meristem from the main stem. Regulates the phyllotaxy throughout the plant development. Seems to act as an inhibitor of cell division. {ECO:0000269\|PubMed:10079219, ECO:0000269\|PubMed:10750709, ECO:0000269\|PubMed:12163400, ECO:0000269\|PubMed:12492830, ECO:0000269\|PubMed:12610213, ECO:0000269\|PubMed:15202996, ECO:0000269\|PubMed:15294871, ECO:0000269\|PubMed:15500463, ECO:0000269\|PubMed:15723790, ECO:0000269\|PubMed:16798887, ECO:0000269\|PubMed:17098808, ECO:0000269\|PubMed:17122068, ECO:0000269\|PubMed:17251269, ECO:0000269\|PubMed:17287247, ECO:0000269\|PubMed:9212461}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00364	DAP	Transfer from AT3G18400	Download

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By BRM and SYD, at the chromatin level, and conferring a very specific spatial expression pattern. Precise spatial regulation by post-transcriptional repression directed by the microRNA miR164. {ECO:0000269\|PubMed:15202996, ECO:0000269\|PubMed:15294871, ECO:0000269\|PubMed:15723790, ECO:0000269\|PubMed:16854978, ECO:0000269\|PubMed:17251269, ECO:0000269\|PubMed:17287247}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK363171	0.0	AK363171.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2013D22.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020181735.1	0.0	protein CUP-SHAPED COTYLEDON 2-like
Swissprot	O04017	5e-77	NAC98_ARATH; Protein CUP-SHAPED COTYLEDON 2
TrEMBL	R7WCZ5	0.0	R7WCZ5_AEGTA; Protein CUP-SHAPED COTYLEDON 2
STRING	EMT20647	0.0	(Aegilops tauschii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP7919	34	50

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G18400.1	4e-94	NAC domain containing protein 58

Publications ? help Back to Top
Wang YX Characterization of a novel Medicago sativa NAC transcription factor gene involved in response to drought stress. Mol. Biol. Rep., 2013. 40(11): p. 6451-8 [PMID:24057250] Kamiuchi Y,Yamamoto K,Furutani M,Tasaka M,Aida M The CUC1 and CUC2 genes promote carpel margin meristem formation during Arabidopsis gynoecium development. Front Plant Sci, 2014. 5: p. 165 [PMID:24817871] Gonçalves B, et al. A conserved role for CUP-SHAPED COTYLEDON genes during ovule development. Plant J., 2015. 83(4): p. 732-42 [PMID:26119568] Du Q,Wang H The role of HD-ZIP III transcription factors and miR165/166 in vascular development and secondary cell wall formation. Plant Signal Behav, 2015. 10(10): p. e1078955 [PMID:26340415] Vialette-Guiraud AC, et al. A Conserved Role for the NAM/miR164 Developmental Module Reveals a Common Mechanism Underlying Carpel Margin Fusion in Monocarpous and Syncarpous Eurosids. Front Plant Sci, 2015. 6: p. 1239 [PMID:26793217] Cui X, et al. REF6 recognizes a specific DNA sequence to demethylate H3K27me3 and regulate organ boundary formation in Arabidopsis. Nat. Genet., 2016. 48(6): p. 694-9 [PMID:27111035] Blein T,Pautot V,Laufs P Combinations of Mutations Sufficient to Alter Arabidopsis Leaf Dissection. Plants (Basel), 2013. 2(2): p. 230-47 [PMID:27137374] Biot E, et al. Multiscale quantification of morphodynamics: MorphoLeaf software for 2D shape analysis. Development, 2016. 143(18): p. 3417-28 [PMID:27387872] Zheng M, et al. Chloroplast Translation Initiation Factors Regulate Leaf Variegation and Development. Plant Physiol., 2016. 172(2): p. 1117-1130 [PMID:27535792] Balkunde R,Kitagawa M,Xu XM,Wang J,Jackson D SHOOT MERISTEMLESS trafficking controls axillary meristem formation, meristem size and organ boundaries in Arabidopsis. Plant J., 2017. 90(3): p. 435-446 [PMID:28161901] Koyama T,Sato F,Ohme-Takagi M Roles of miR319 and TCP Transcription Factors in Leaf Development. Plant Physiol., 2017. 175(2): p. 874-885 [PMID:28842549] González-Carranza ZH, et al. HAWAIIAN SKIRT controls size and floral organ number by modulating CUC1 and CUC2 expression. PLoS ONE, 2017. 12(9): p. e0185106 [PMID:28934292] Wilson-Sánchez D,Martínez-López S,Navarro-Cartagena S,Jover-Gil S,Micol JL Members of the DEAL subfamily of the DUF1218 gene family are required for bilateral symmetry but not for dorsoventrality in Arabidopsis leaves. New Phytol., 2018. 217(3): p. 1307-1321 [PMID:29139551] Gonçalves B, et al. GDP-L-fucose is required for boundary definition in plants. J. Exp. Bot., 2017. 68(21-22): p. 5801-5811 [PMID:29186469] Sha S, et al. To be serrate or pinnate: diverse leaf forms of yarrows (Achillea) are linked to differential expression patterns of NAM genes. Ann. Bot., 2018. 121(2): p. 255-266 [PMID:29267935] Maugarny-Calès A, et al. Dissecting the pathways coordinating patterning and growth by plant boundary domains. PLoS Genet., 2019. 15(1): p. e1007913 [PMID:30677017]