PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EMT18750 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
|
||||||||
Family | GRAS | ||||||||
Protein Properties | Length: 126aa MW: 14415.9 Da PI: 5.652 | ||||||||
Description | GRAS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GRAS | 72.9 | 6e-23 | 32 | 124 | 252 | 344 |
GRAS 252 sFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkv 344 +++ fl+al+yys++f sl+a++p++ +kvE+ ll+ ei++vv egaer++rhe+l +W++ +e+ GF+ v ls a q + ll + EMT18750 32 ELVYSFLKALQYYSVIFGSLDATFPADLASWMKVEQCLLAMEICSVVVFEGAERVARHERLDRWHRIMEDHGFEVVLLSLAAGVQSQVLLGLY 124 57789************************************************************************************9887 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50985 | 14.551 | 1 | 126 | IPR005202 | Transcription factor GRAS |
Pfam | PF03514 | 2.1E-20 | 32 | 124 | IPR005202 | Transcription factor GRAS |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 126 aa Download sequence Send to blast |
MPERKPCFLL VLASTEGQNS FILEKGIKFI TELVYSFLKA LQYYSVIFGS LDATFPADLA 60 SWMKVEQCLL AMEICSVVVF EGAERVARHE RLDRWHRIME DHGFEVVLLS LAAGVQSQVL 120 LGLYRW |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that functions in mycorrhizal specific signaling (PubMed:23122845). Required for Myc factor signaling from mycorrhizal fungi, but has no function in Nod factor signaling from rhizobial bacteria (PubMed:23122845). Regulates the expression of RAM2, a glycerol-3-phosphate acyl transferase that promotes cutin biosynthesis to enhance mycorrhizal hyphopodia formation (PubMed:23122845). {ECO:0000269|PubMed:23122845}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced in roots during colonization by arbuscular mycorrhizal fungi. {ECO:0000269|PubMed:23122845}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020178448.1 | 6e-36 | DELLA protein RGL1-like | ||||
Swissprot | G7L166 | 1e-25 | RAM1_MEDTR; GRAS family protein RAM1 | ||||
TrEMBL | R7WEC8 | 2e-87 | R7WEC8_AEGTA; Uncharacterized protein | ||||
STRING | EMT18750 | 3e-88 | (Aegilops tauschii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP9221 | 31 | 41 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G48150.2 | 6e-13 | GRAS family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|