PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EMT16519 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 217aa MW: 23835.1 Da PI: 5.7487 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 151 | 2.3e-47 | 1 | 81 | 17 | 97 |
NF-YB 17 mkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 mkk++Pan+ki+kdaketvqecvsefisf+tseasdkcqrekrktingddllwa+atlGfe+y+eplkvyl+kyre+eg++ EMT16519 1 MKKAIPANGKIAKDAKETVQECVSEFISFITSEASDKCQREKRKTINGDDLLWAMATLGFEEYIEPLKVYLQKYRETEGDS 81 9******************************************************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF00808 | 3.7E-21 | 1 | 55 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
SuperFamily | SSF47113 | 1.63E-31 | 1 | 89 | IPR009072 | Histone-fold |
Gene3D | G3DSA:1.10.20.10 | 5.0E-43 | 1 | 86 | IPR009072 | Histone-fold |
PRINTS | PR00615 | 1.4E-22 | 19 | 37 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 22 | 38 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 1.4E-22 | 38 | 56 | No hit | No description |
PRINTS | PR00615 | 1.4E-22 | 57 | 75 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 217 aa Download sequence Send to blast |
MKKAIPANGK IAKDAKETVQ ECVSEFISFI TSEASDKCQR EKRKTINGDD LLWAMATLGF 60 EEYIEPLKVY LQKYRETEGD SKLAGKSGDV SVKKDALGPH GGSSGTSAQG MGQQVAYNPG 120 MVYMQPQRSI SDYNFQHSMS TCNVFFFGTR NLFVRDNRNS LITIMGTSQT EDMDHLSDCC 180 SSACLVVAVI RFRIIWVFGG DITPPGVVCP ELAVSDS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1n1j_A | 4e-38 | 1 | 76 | 18 | 93 | NF-YB |
4awl_B | 3e-38 | 1 | 76 | 19 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
4csr_A | 3e-38 | 1 | 76 | 19 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT009078 | 0.0 | BT009078.1 Triticum aestivum clone wkm1c.pk0002.d7:fis, full insert mRNA sequence. | |||
GenBank | GU902786 | 0.0 | GU902786.1 Triticum monococcum nuclear transcription factor Y subunit B2 mRNA, partial cds. | |||
GenBank | KM078735 | 0.0 | KM078735.1 Triticum aestivum CCAAT-binding transcription factor A (NFYB-A2) mRNA, complete cds. | |||
GenBank | KM078737 | 0.0 | KM078737.1 Triticum aestivum CCAAT-binding transcription factor A (NFYB-D2) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020176773.1 | 2e-88 | nuclear transcription factor Y subunit B-3-like isoform X1 | ||||
Swissprot | P25209 | 7e-74 | NFYB_MAIZE; Nuclear transcription factor Y subunit B | ||||
TrEMBL | R7WD11 | 1e-162 | R7WD11_AEGTA; Nuclear transcription factor Y subunit B | ||||
STRING | EMT16519 | 1e-163 | (Aegilops tauschii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP201 | 38 | 331 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G53340.1 | 3e-54 | nuclear factor Y, subunit B10 |
Publications ? help Back to Top | |||
---|---|---|---|
|