PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT15724
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family TALE
Protein Properties Length: 153aa    MW: 17646.8 Da    PI: 6.7903
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT15724genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox30.75.3e-10851172355
               SS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
  Homeobox  23 rypsaeereeLAkklgLterqVkvWFqNrRake 55 
               +yp++e++ +LA+ +gL+ rq+ +WF N+R ++
  EMT15724  85 PYPTEEDKVRLAAMTGLDPRQINNWFVNQRKRH 117
               8*****************************985 PP

2ELK35.81.8e-123758122
       ELK  1 ELKhqLlrKYsgyLgsLkqEFs 22
              EL+++Ll+KYsg+L+ L++EF+
  EMT15724 37 ELREMLLNKYSGCLSHLRTEFL 58
              9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011883.5E-63758IPR005539ELK domain
PROSITE profilePS5121310.0393757IPR005539ELK domain
PfamPF037893.2E-93758IPR005539ELK domain
PROSITE profilePS5007112.40657120IPR001356Homeobox domain
SMARTSM003891.4E-1259124IPR001356Homeobox domain
SuperFamilySSF466892.48E-2059129IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.3E-2662122IPR009057Homeodomain-like
PfamPF059201.3E-1677116IPR008422Homeobox KN domain
CDDcd000861.93E-1183121No hitNo description
PROSITE patternPS00027095118IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 153 aa     Download sequence    Send to blast
MMQDEMVESS EDEPYSGDTG ASDAGMQEQS SRLADRELRE MLLNKYSGCL SHLRTEFLKK  60
RKKGKLPKDA RLALVDWWNT HYRWPYPTEE DKVRLAAMTG LDPRQINNWF VNQRKRHWKP  120
SEDMRFALME GVTGGGGGSS YDTTLCFGTD SMR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
15261LRTEFLKKRK
25862KKRKK
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that may be involved in shoot formation during embryogenesis. {ECO:0000269|PubMed:10080693}.
UniProtProbable transcription factor that may be involved in shoot formation during embryogenesis. {ECO:0000269|PubMed:10080693, ECO:0000269|PubMed:10488233}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3636151e-154AK363615.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2017F18.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020158428.11e-109homeobox protein knotted-1-like 10
SwissprotA2Y0072e-72KNOSA_ORYSI; Homeobox protein knotted-1-like 10
SwissprotQ7GDL52e-72KNOSA_ORYSJ; Homeobox protein knotted-1-like 10
TrEMBLA0A452XVJ11e-111A0A452XVJ1_AEGTS; Uncharacterized protein
TrEMBLN1QY031e-111N1QY03_AEGTA; Homeobox protein knotted-1-like 10
STRINGEMT157241e-112(Aegilops tauschii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP16983892
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G23380.23e-39KNOTTED1-like homeobox gene 6
Publications ? help Back to Top
  1. Ito Y,Eiguchi M,Kurata N
    KNOX homeobox genes are sufficient in maintaining cultured cells in an undifferentiated state in rice.
    Genesis, 2001. 30(4): p. 231-8
    [PMID:11536429]
  2. Postma-Haarsma AD, et al.
    Developmental regulation and downstream effects of the knox class homeobox genes Oskn2 and Oskn3 from rice.
    Plant Mol. Biol., 2002. 48(4): p. 423-41
    [PMID:11908517]
  3. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  4. Kuijt SJ, et al.
    Different subcellular localization and trafficking properties of KNOX class 1 homeodomain proteins from rice.
    Plant Mol. Biol., 2004. 55(6): p. 781-96
    [PMID:15604716]
  5. Cheng CH, et al.
    A fine physical map of the rice chromosome 5.
    Mol. Genet. Genomics, 2005. 274(4): p. 337-45
    [PMID:16261349]
  6. Chu H, et al.
    A CLE-WOX signalling module regulates root meristem maintenance and vascular tissue development in rice.
    J. Exp. Bot., 2013. 64(17): p. 5359-69
    [PMID:24043854]
  7. Kuijt SJ, et al.
    Interaction between the GROWTH-REGULATING FACTOR and KNOTTED1-LIKE HOMEOBOX families of transcription factors.
    Plant Physiol., 2014. 164(4): p. 1952-66
    [PMID:24532604]
  8. Coudert Y, et al.
    Identification of CROWN ROOTLESS1-regulated genes in rice reveals specific and conserved elements of postembryonic root formation.
    New Phytol., 2015. 206(1): p. 243-54
    [PMID:25442012]
  9. Xu Y, et al.
    OsARID3, an AT-rich Interaction Domain-containing protein, is required for shoot meristem development in rice.
    Plant J., 2015. 83(5): p. 806-17
    [PMID:26121094]
  10. Kir G, et al.
    RNA Interference Knockdown of BRASSINOSTEROID INSENSITIVE1 in Maize Reveals Novel Functions for Brassinosteroid Signaling in Controlling Plant Architecture.
    Plant Physiol., 2015. 169(1): p. 826-39
    [PMID:26162429]