PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EMT15724 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
|
||||||||
Family | TALE | ||||||||
Protein Properties | Length: 153aa MW: 17646.8 Da PI: 6.7903 | ||||||||
Description | TALE family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 30.7 | 5.3e-10 | 85 | 117 | 23 | 55 |
SS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS Homeobox 23 rypsaeereeLAkklgLterqVkvWFqNrRake 55 +yp++e++ +LA+ +gL+ rq+ +WF N+R ++ EMT15724 85 PYPTEEDKVRLAAMTGLDPRQINNWFVNQRKRH 117 8*****************************985 PP | |||||||
2 | ELK | 35.8 | 1.8e-12 | 37 | 58 | 1 | 22 |
ELK 1 ELKhqLlrKYsgyLgsLkqEFs 22 EL+++Ll+KYsg+L+ L++EF+ EMT15724 37 ELREMLLNKYSGCLSHLRTEFL 58 9********************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM01188 | 3.5E-6 | 37 | 58 | IPR005539 | ELK domain |
PROSITE profile | PS51213 | 10.039 | 37 | 57 | IPR005539 | ELK domain |
Pfam | PF03789 | 3.2E-9 | 37 | 58 | IPR005539 | ELK domain |
PROSITE profile | PS50071 | 12.406 | 57 | 120 | IPR001356 | Homeobox domain |
SMART | SM00389 | 1.4E-12 | 59 | 124 | IPR001356 | Homeobox domain |
SuperFamily | SSF46689 | 2.48E-20 | 59 | 129 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 5.3E-26 | 62 | 122 | IPR009057 | Homeodomain-like |
Pfam | PF05920 | 1.3E-16 | 77 | 116 | IPR008422 | Homeobox KN domain |
CDD | cd00086 | 1.93E-11 | 83 | 121 | No hit | No description |
PROSITE pattern | PS00027 | 0 | 95 | 118 | IPR017970 | Homeobox, conserved site |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 153 aa Download sequence Send to blast |
MMQDEMVESS EDEPYSGDTG ASDAGMQEQS SRLADRELRE MLLNKYSGCL SHLRTEFLKK 60 RKKGKLPKDA RLALVDWWNT HYRWPYPTEE DKVRLAAMTG LDPRQINNWF VNQRKRHWKP 120 SEDMRFALME GVTGGGGGSS YDTTLCFGTD SMR |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 52 | 61 | LRTEFLKKRK |
2 | 58 | 62 | KKRKK |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that may be involved in shoot formation during embryogenesis. {ECO:0000269|PubMed:10080693}. | |||||
UniProt | Probable transcription factor that may be involved in shoot formation during embryogenesis. {ECO:0000269|PubMed:10080693, ECO:0000269|PubMed:10488233}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK363615 | 1e-154 | AK363615.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2017F18. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020158428.1 | 1e-109 | homeobox protein knotted-1-like 10 | ||||
Swissprot | A2Y007 | 2e-72 | KNOSA_ORYSI; Homeobox protein knotted-1-like 10 | ||||
Swissprot | Q7GDL5 | 2e-72 | KNOSA_ORYSJ; Homeobox protein knotted-1-like 10 | ||||
TrEMBL | A0A452XVJ1 | 1e-111 | A0A452XVJ1_AEGTS; Uncharacterized protein | ||||
TrEMBL | N1QY03 | 1e-111 | N1QY03_AEGTA; Homeobox protein knotted-1-like 10 | ||||
STRING | EMT15724 | 1e-112 | (Aegilops tauschii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1698 | 38 | 92 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G23380.2 | 3e-39 | KNOTTED1-like homeobox gene 6 |