PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EMT15300 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
|
||||||||
Family | HB-other | ||||||||
Protein Properties | Length: 54aa MW: 6593.65 Da PI: 10.1163 | ||||||||
Description | HB-other family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 60 | 3.9e-19 | 3 | 53 | 7 | 57 |
--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS Homeobox 7 ftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 ++++q+++Le+ F+ + yp++ +r++L ++lg++ +q+k+WF+NrRa++++ EMT15300 3 ISDNQIQILERTFKVCLYPDEIQRADLGRELGVQPQQIKFWFKNRRAQMRR 53 6899*********************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50071 | 15.694 | 1 | 54 | IPR001356 | Homeobox domain |
Pfam | PF00046 | 1.2E-16 | 3 | 53 | IPR001356 | Homeobox domain |
CDD | cd00086 | 1.48E-12 | 3 | 53 | No hit | No description |
SMART | SM00389 | 1.8E-5 | 3 | 54 | IPR001356 | Homeobox domain |
SuperFamily | SSF46689 | 1.23E-16 | 3 | 53 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 9.9E-18 | 4 | 53 | IPR009057 | Homeodomain-like |
PRINTS | PR00031 | 4.2E-5 | 25 | 34 | IPR000047 | Helix-turn-helix motif |
PRINTS | PR00031 | 4.2E-5 | 34 | 50 | IPR000047 | Helix-turn-helix motif |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 54 aa Download sequence Send to blast |
MDISDNQIQI LERTFKVCLY PDEIQRADLG RELGVQPQQI KFWFKNRRAQ MRRI |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015967008.1 | 2e-15 | homeobox-leucine zipper protein HDG11 | ||||
Refseq | XP_020980110.1 | 2e-15 | homeobox-leucine zipper protein HDG11-like isoform X1 | ||||
Refseq | XP_020980112.1 | 2e-15 | homeobox-leucine zipper protein HDG11-like isoform X2 | ||||
Refseq | XP_020980113.1 | 2e-15 | homeobox-leucine zipper protein HDG11-like isoform X2 | ||||
Refseq | XP_020980114.1 | 2e-15 | homeobox-leucine zipper protein HDG11-like isoform X2 | ||||
Refseq | XP_025655491.1 | 2e-15 | homeobox-leucine zipper protein HDG11 | ||||
Refseq | XP_025701434.1 | 2e-15 | homeobox-leucine zipper protein HDG11 | ||||
Refseq | XP_029149194.1 | 2e-15 | homeobox-leucine zipper protein HDG11 | ||||
Refseq | XP_029149195.1 | 2e-15 | homeobox-leucine zipper protein HDG11 | ||||
Refseq | XP_029154366.1 | 2e-15 | homeobox-leucine zipper protein HDG11 | ||||
Refseq | XP_029154367.1 | 2e-15 | homeobox-leucine zipper protein HDG11 | ||||
Refseq | XP_029154368.1 | 2e-15 | homeobox-leucine zipper protein HDG11 | ||||
Swissprot | Q69T58 | 4e-16 | ROC8_ORYSJ; Homeobox-leucine zipper protein ROC8 | ||||
TrEMBL | R7W947 | 1e-31 | R7W947_AEGTA; Homeobox-leucine zipper protein ROC8 | ||||
STRING | EMT15300 | 2e-32 | (Aegilops tauschii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP37023 | 3 | 3 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G73360.1 | 2e-17 | homeodomain GLABROUS 11 |