PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EMT15029 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
|
||||||||
Family | HSF | ||||||||
Protein Properties | Length: 91aa MW: 9709.01 Da PI: 9.8635 | ||||||||
Description | HSF family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | HSF_DNA-bind | 71.2 | 2e-22 | 14 | 71 | 3 | 60 |
HHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS HSF_DNA-bind 3 lkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60 + k+y+++ed+ ++ +i w + +nsfvv d+ f++++Lp +Fkh+nf+SFvRQLn+Y EMT15029 14 VWKTYRMVEDPGTDGVIGWGKGNNSFVVADPFVFSQTMLPAHFKHNNFSSFVRQLNTY 71 569******************************************************* PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00415 | 9.6E-15 | 9 | 88 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 3.5E-12 | 13 | 36 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Gene3D | G3DSA:1.10.10.10 | 2.8E-24 | 14 | 78 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
SuperFamily | SSF46785 | 3.67E-21 | 14 | 72 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
Pfam | PF00447 | 6.9E-18 | 16 | 71 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 3.5E-12 | 51 | 63 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 3.5E-12 | 64 | 76 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 91 aa Download sequence Send to blast |
MAAASVGGGG APGVWKTYRM VEDPGTDGVI GWGKGNNSFV VADPFVFSQT MLPAHFKHNN 60 FSSFVRQLNT YVSQLIPTRS VGSVVNSFSI I |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5d5w_B | 1e-16 | 14 | 71 | 5 | 62 | Putative transcription factor |
5d5x_B | 1e-16 | 14 | 71 | 5 | 62 | Putative transcription factor |
5d5x_E | 1e-16 | 14 | 71 | 5 | 62 | Putative transcription factor |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional regulator that specifically binds DNA of heat shock promoter elements (HSE). {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KF234653 | 1e-104 | KF234653.1 Triticum aestivum heat shock factor C2a (HsfC2a) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015641665.1 | 1e-37 | heat stress transcription factor C-2b | ||||
Swissprot | Q0DBL6 | 1e-38 | HFC2B_ORYSJ; Heat stress transcription factor C-2b | ||||
TrEMBL | R7WAD2 | 1e-59 | R7WAD2_AEGTA; Uncharacterized protein | ||||
STRING | EMT15029 | 2e-60 | (Aegilops tauschii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP4471 | 34 | 70 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G24520.1 | 6e-24 | heat shock transcription factor C1 |