PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EMT14910 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
|
||||||||
Family | Whirly | ||||||||
Protein Properties | Length: 219aa MW: 25027.7 Da PI: 9.8448 | ||||||||
Description | Whirly family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Whirly | 36 | 1.3e-11 | 26 | 60 | 22 | 56 |
Whirly 22 dsgnlklkraGglllelanataerkydWekkqsfa 56 +sg+ k+ ++G++ll++a+a+++r+ydW +kq EMT14910 26 QSGAYKVAKEGFVLLQFAPAVGPRQYDWTRKQLPK 60 589****************************9654 PP | |||||||
2 | Whirly | 112.4 | 3.3e-35 | 96 | 182 | 53 | 139 |
Whirly 53 qsfalsatevaelvdlaskesceffhdpaakgsneGkvrkalkvePlpdGsGlfvnlsvtnslvkgnesfsvPvskaefavlrsllv 139 ++f+ls+ e+++l+ l+ +sceffhdp+++ s+eGkvrk+lkveP pdG G f+nlsv+n l++++e++++P++k+e+av+ s ++ EMT14910 96 DVFSLSVWEMGTLLTLGLTDSCEFFHDPFKGRSDEGKVRKVLKVEPTPDGNGRFFNLSVQNRLLNVDENIYIPITKGEYAVIVSTFN 182 58********************************************************************************99875 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.30.31.10 | 9.0E-12 | 22 | 60 | IPR009044 | ssDNA-binding transcriptional regulator |
SuperFamily | SSF54447 | 3.84E-8 | 26 | 79 | IPR009044 | ssDNA-binding transcriptional regulator |
Pfam | PF08536 | 1.1E-10 | 26 | 62 | IPR013742 | Plant transcription factor |
SuperFamily | SSF54447 | 1.41E-45 | 97 | 219 | IPR009044 | ssDNA-binding transcriptional regulator |
Pfam | PF08536 | 7.0E-32 | 97 | 179 | IPR013742 | Plant transcription factor |
Gene3D | G3DSA:2.30.31.10 | 1.0E-44 | 97 | 204 | IPR009044 | ssDNA-binding transcriptional regulator |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006281 | Biological Process | DNA repair | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0045910 | Biological Process | negative regulation of DNA recombination | ||||
GO:0009508 | Cellular Component | plastid chromosome | ||||
GO:0009570 | Cellular Component | chloroplast stroma | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0003723 | Molecular Function | RNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 219 aa Download sequence Send to blast |
MGFSIDGPGR GLGFLPRALL GPAYGQSGAY KVAKEGFVLL QFAPAVGPRQ YDWTRKQLPK 60 TSVYARLNSM VWFRQKEKKT YITLKNEFQA KIYIVDVFSL SVWEMGTLLT LGLTDSCEFF 120 HDPFKGRSDE GKVRKVLKVE PTPDGNGRFF NLSVQNRLLN VDENIYIPIT KGEYAVIVST 180 FNYIIPHIMG WSTFTNSIKP EESQPYNRPQ SSPELEWRR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1l3a_A | 2e-68 | 1 | 217 | 40 | 218 | p24: plant transcriptional regulator PBF-2 |
1l3a_B | 2e-68 | 1 | 217 | 40 | 218 | p24: plant transcriptional regulator PBF-2 |
1l3a_C | 2e-68 | 1 | 217 | 40 | 218 | p24: plant transcriptional regulator PBF-2 |
1l3a_D | 2e-68 | 1 | 217 | 40 | 218 | p24: plant transcriptional regulator PBF-2 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Single-stranded DNA and RNA binding protein that maintains plastid genome stability by preventing break-induced and short homology-dependent illegitimate recombinations. Functions in RNA metabolism and is involved in the maturation of the atpF and 23S ribosomal RNAs. {ECO:0000269|PubMed:18676978, ECO:0000269|PubMed:19666500}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK353795 | 1e-171 | AK353795.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1002M22. | |||
GenBank | AK365452 | 1e-171 | AK365452.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2034E15. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020186783.1 | 1e-104 | single-stranded DNA-binding protein WHY1, chloroplastic-like | ||||
Swissprot | B2LXS7 | 7e-92 | WHY1_MAIZE; Single-stranded DNA-binding protein WHY1, chloroplastic | ||||
TrEMBL | R7W8E9 | 1e-161 | R7W8E9_AEGTA; Uncharacterized protein | ||||
STRING | EMT14910 | 1e-162 | (Aegilops tauschii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP3012 | 38 | 85 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G02740.2 | 4e-73 | ssDNA-binding transcriptional regulator |
Publications ? help Back to Top | |||
---|---|---|---|
|