PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EMT14182 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 113aa MW: 12900.1 Da PI: 9.8509 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 56.3 | 7.6e-18 | 15 | 62 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd+llvd+v+ +g+W+ ++ g++R++k+c++rw +yl EMT14182 15 KGPWTPEEDKLLVDYVQANAPGNWRMLPKLAGLNRCGKSCRLRWTNYL 62 79********************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 5.8E-23 | 7 | 65 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 23.996 | 10 | 66 | IPR017930 | Myb domain |
SMART | SM00717 | 9.5E-13 | 14 | 64 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.8E-15 | 15 | 62 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 1.45E-23 | 16 | 90 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.79E-10 | 17 | 62 | No hit | No description |
PROSITE profile | PS50090 | 3.903 | 63 | 113 | IPR017877 | Myb-like domain |
Gene3D | G3DSA:1.10.10.60 | 1.1E-8 | 66 | 89 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 113 aa Download sequence Send to blast |
MGRTPCCESR QGLKKGPWTP EEDKLLVDYV QANAPGNWRM LPKLAGLNRC GKSCRLRWTN 60 YLRPDIKRGP FTPEEHKSIL QLHAIVGNKS VLLLLLLTHF VPLQYTCVSS HVY |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 4e-17 | 13 | 97 | 25 | 108 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that may function in salt stress response. {ECO:0000305|PubMed:26139822}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by salt stress. {ECO:0000269|PubMed:26139822}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK108621 | 1e-98 | AK108621.1 Oryza sativa Japonica Group cDNA clone:002-147-D04, full insert sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020156867.1 | 2e-62 | myb-related protein Myb4-like | ||||
Swissprot | Q9M0Y5 | 3e-44 | MYB74_ARATH; Transcription factor MYB74 | ||||
TrEMBL | N1QV87 | 8e-79 | N1QV87_AEGTA; Transcription factor MYB39 | ||||
STRING | EMT14182 | 1e-79 | (Aegilops tauschii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP5409 | 31 | 57 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G05100.1 | 2e-46 | myb domain protein 74 |
Publications ? help Back to Top | |||
---|---|---|---|
|