PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EMT13974 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 175aa MW: 19854.1 Da PI: 8.2235 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 25.5 | 3e-08 | 13 | 59 | 1 | 45 |
TSSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwq 45 r +W +eEd+ + a l+ +W+++a++++ gRt+ + +++q EMT13974 13 RRPWAKEEDKAFEAALVTLPDQapdRWERVAARLP-GRTPQEAWEHYQ 59 679*****************99*************.****98777777 PP | |||||||
2 | Myb_DNA-binding | 45.8 | 1.4e-14 | 108 | 152 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +W++eE++l++d+ +++G g+W+ I+r Rt+ q+ s+ qky EMT13974 108 PWSEEEHKLFLDGLEKYGRGDWRNISRFAVRSRTPTQVASHAQKY 152 7*******************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 9.199 | 8 | 66 | IPR017930 | Myb domain |
SMART | SM00717 | 3.9E-5 | 12 | 64 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 2.73E-10 | 12 | 61 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 1.2E-6 | 13 | 60 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 2.7E-6 | 13 | 59 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 5.38E-4 | 18 | 53 | No hit | No description |
PROSITE profile | PS51294 | 17.856 | 101 | 157 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 4.74E-17 | 103 | 158 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 9.7E-11 | 105 | 155 | IPR001005 | SANT/Myb domain |
TIGRFAMs | TIGR01557 | 1.4E-16 | 106 | 156 | IPR006447 | Myb domain, plants |
Gene3D | G3DSA:1.10.10.60 | 2.5E-11 | 108 | 151 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 5.5E-12 | 108 | 152 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 8.32E-11 | 108 | 153 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 175 aa Download sequence Send to blast |
MDLYYQQAAP AARRPWAKEE DKAFEAALVT LPDQAPDRWE RVAARLPGRT PQEAWEHYQA 60 LVADVDLIER GAVDTPGCWD DDDGCTAAAA PGRRAGKPRG EERRRGIPWS EEEHKLFLDG 120 LEKYGRGDWR NISRFAVRSR TPTQVASHAQ KYFIRQANAA TRDSKRKSIH DITTP |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
2cjj_A | 5e-14 | 14 | 77 | 9 | 72 | RADIALIS |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Involved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269|PubMed:11937495, ECO:0000269|PubMed:9118809}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK367373 | 0.0 | AK367373.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2055O05. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020158558.1 | 1e-126 | transcription factor DIVARICATA-like | ||||
Swissprot | Q8S9H7 | 4e-51 | DIV_ANTMA; Transcription factor DIVARICATA | ||||
TrEMBL | A0A3B6H1T2 | 1e-124 | A0A3B6H1T2_WHEAT; Uncharacterized protein | ||||
TrEMBL | R7W8K0 | 1e-124 | R7W8K0_AEGTA; Myb-like protein J | ||||
STRING | EMT13974 | 1e-125 | (Aegilops tauschii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2895 | 36 | 87 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G04760.1 | 2e-44 | MYB family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|