PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT12590
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family TALE
Protein Properties Length: 629aa    MW: 67951 Da    PI: 8.7627
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT12590genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox30.65.7e-103864231954
               HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
  Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
               Fe   ++yp+  +++ LAk++gLt +qV++WF N R +
  EMT12590 386 FEHflHPYPTDGDKQMLAKQTGLTRNQVSNWFINARVR 423
               554459******************************88 PP

2BELL71.51.4e-232653191872
      BELL  18 eVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                V+krY+qy++q+q+vi+sFe vag  +a+p+t+lAl+ ++rhFrc+k +i +q+
  EMT12590 265 RVCKRYRQYYQQVQAVIASFESVAGFSNAAPFTALALRVMARHFRCIKGMILSQL 319
               79*************************************************9996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.0E-21145317IPR006563POX domain
PfamPF075261.3E-34150315IPR006563POX domain
PROSITE profilePS5007112.26364427IPR001356Homeobox domain
CDDcd000862.56E-12367428No hitNo description
SMARTSM003893.8E-10367431IPR001356Homeobox domain
SuperFamilySSF466894.71E-17369436IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.7E-28370431IPR009057Homeodomain-like
PfamPF059206.8E-19384423IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 629 aa     Download sequence    Send to blast
MAPAAAAASG GQLYHVPQHS RREKLRFPPD AAAEDSPPTP LAHHHHQQHQ QHQAGAWPPP  60
AFYSYASSSS SYSPHSPTVP QGQQLVLNGL TAQQVTAQQF PQIPTQNFSL SLSSASSNPA  120
TTPPAPRKQE PGAAAPAAWP YGPFTGYATV LGRSRFLGPA QKLLEEICDV GGAAAHADTS  180
VLDEGLLDAD AMDGADDAAG HELDTSGPMS GAEQQWKKTR LISMMEERIK DWMLISFTAL  240
STPFANIICY MKPQLISSVL ERFGRVCKRY RQYYQQVQAV IASFESVAGF SNAAPFTALA  300
LRVMARHFRC IKGMILSQLR NTSKMPVKEG MSKDITIFGL GGGGGAPVGG FQRGGSVNGF  360
GQPHNIWRPQ RGLPERSVTV LRAWLFEHFL HPYPTDGDKQ MLAKQTGLTR NQVSNWFINA  420
RVRLWKPMVE EIHNVEMRQV HKHSPHDKGQ QNGVHGQAHQ HSSQQQQQRS GKRSEPCDSH  480
PGQSSGVTRN HHHHNAAAAA SSHGGGFPDD LSQLSHSMQQ GQVTFAGYGA LPSQQQHGSM  540
ASPQHHHHHH VGVGVGGAVN AGGGGGGSLT LGLHQNNRVC FGEPLPANLA HRFGLEDVVS  600
DPYVMGSFGG QDRHFAKEIG GHLLHDFVG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A6e-16373431563Homeobox protein Meis2
3k2a_B6e-16373431563Homeobox protein Meis2
4xrs_A5e-16373430158Homeobox protein Meis1
4xrs_B5e-16373430158Homeobox protein Meis1
5bng_A6e-16373431159Homeobox protein Meis2
5bng_B6e-16373431159Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB5466470.0AB546647.1 Triticum aestivum WBLH4 mRNA for BEL1-type homeodomain protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020175344.10.0BEL1-like homeodomain protein 9
TrEMBLM8BFS70.0M8BFS7_AEGTA; BEL1-like homeodomain protein 9
STRINGEMT125900.0(Aegilops tauschii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25283881
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27990.12e-50BEL1-like homeodomain 8