PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT07957
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family TALE
Protein Properties Length: 473aa    MW: 50960.2 Da    PI: 6.9186
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT07957genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.72.2e-093273641954
               HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
  Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
               Fe   n+yps  ++  LA+++gL+ +qV++WF N R +
  EMT07957 327 FEHflNPYPSDVDKHILARQTGLSRSQVSNWFINARVR 364
               665569******************************88 PP

2BELL80.62e-26189257472
      BELL   4 elqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
               el++ k +L  +leeVd+rY++y+eq++ +++ Feavag  +a  Yt++A ++iSrhFr+L+d i+ q+
  EMT07957 189 ELKRLKDRLYVMLEEVDRRYRRYCEQMRGLAGGFEAVAGERAASGYTAVAARTISRHFRSLRDGIVAQL 257
               7788899***********************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.4E-31110255IPR006563POX domain
PfamPF075264.0E-38116253IPR006563POX domain
PROSITE profilePS5007112.341305368IPR001356Homeobox domain
CDDcd000861.01E-12308369No hitNo description
SMARTSM003892.2E-8308372IPR001356Homeobox domain
SuperFamilySSF466891.88E-17309373IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.7E-26311371IPR009057Homeodomain-like
PfamPF059205.3E-18325364IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 473 aa     Download sequence    Send to blast
MAHDPSLGFA DYFSAADAAA ASLMPQMDEG APELYGLQSG MELLGMRGLH AAAMSGAMSV  60
SADVHCDGGG DGHDGSTMRF FLEQQQQHEA SAASWMLPHE HEAATYAHGH GAAWPLRSSR  120
FLLPAQQLLP GYCSLPVDLT PQRGKQPPEP QQQQQQQQQQ DEAGGGEVSS SSTSGWTPSA  180
QIQAMEALEL KRLKDRLYVM LEEVDRRYRR YCEQMRGLAG GFEAVAGERA ASGYTAVAAR  240
TISRHFRSLR DGIVAQLQAV RKALGEKDVA PPGMTRGDTP RLKVLDQCIR QQKAMHQNGG  300
MMMDSHPWRP QRGLPERAVT ILRAWLFEHF LNPYPSDVDK HILARQTGLS RSQVSNWFIN  360
ARVRLWKPMG QGGFGGGAGG VSLTLGLQQH DTHGGVGGVN IAFGAPSSAQ HGAGGFLFPG  420
EQMDGVGLHP SGGHGQNIQF GMDGAAEGSS HGVQDQHYRA MSAGFHLLRD LAG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A3e-15314369156Homeobox protein Meis1
4xrs_B3e-15314369156Homeobox protein Meis1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that establishes leaf shape by repressing growth in specific subdomains of the leaf. Negatively regulates knox homeobox gene KNAT1/BP expression. {ECO:0000269|PubMed:17873098}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3678000.0AK367800.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2062I16.
GenBankAK3721850.0AK372185.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2147N13.
GenBankAK3730890.0AK373089.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3020M01.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020184600.10.0homeobox protein BEL1 homolog
RefseqXP_020184605.10.0homeobox protein BEL1 homolog
RefseqXP_020184610.10.0homeobox protein BEL1 homolog
RefseqXP_020184619.10.0homeobox protein BEL1 homolog
SwissprotQ94KL56e-77BLH4_ARATH; BEL1-like homeodomain protein 4
TrEMBLM8AU030.0M8AU03_AEGTA; BEL1-like homeodomain protein 4
STRINGEMT079570.0(Aegilops tauschii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38143764
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23760.39e-78BEL1-like homeodomain 4
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]