PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT07955
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family TALE
Protein Properties Length: 162aa    MW: 18796.4 Da    PI: 8.9412
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT07955genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox24.83.7e-081121452154
               HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
  Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
               k +yp+++++++L +++gL+ +q+ +WF N+R +
  EMT07955 112 KWPYPTEDDKAKLVEETGLQLKQINNWFINQRKR 145
               579*****************************87 PP

2ELK28.92.5e-106687122
       ELK  1 ELKhqLlrKYsgyLgsLkqEFs 22
              ELK +L++++++++g++++E++
  EMT07955 66 ELKIELKQGFKSRIGDVREEIL 87
              9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF037898.9E-76687IPR005539ELK domain
PROSITE profilePS512139.2896686IPR005539ELK domain
SMARTSM011880.00496687IPR005539ELK domain
PROSITE profilePS5007111.7186149IPR001356Homeobox domain
SuperFamilySSF466891.11E-1688153IPR009057Homeodomain-like
SMARTSM003894.2E-1088153IPR001356Homeobox domain
CDDcd000862.00E-1189150No hitNo description
Gene3DG3DSA:1.10.10.602.7E-2593152IPR009057Homeodomain-like
PfamPF059202.9E-18106145IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007155Biological Processcell adhesion
GO:0010089Biological Processxylem development
GO:0010090Biological Processtrichome morphogenesis
GO:0010192Biological Processmucilage biosynthetic process
GO:0045010Biological Processactin nucleation
GO:0045492Biological Processxylan biosynthetic process
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048513Biological Processanimal organ development
GO:0048765Biological Processroot hair cell differentiation
GO:0071555Biological Processcell wall organization
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 162 aa     Download sequence    Send to blast
MWMYGSGASL EEGMGATMSE DEDEGPPMIM EAAPMDMSSN GHDMMGFGPL VPTDTERSLM  60
ERVRQELKIE LKQGFKSRIG DVREEILRKR RAGKLPGDTT TILKQWWQEH AKWPYPTEDD  120
KAKLVEETGL QLKQINNWFI NQRKRNWHNN SQTSTLKSKR KR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1142161RKRNWHNNSQTSTLKSKRKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3695360.0AK369536.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2093A15.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020184577.11e-113homeobox protein knotted-1-like 3
SwissprotQ94LW34e-99KNOS3_ORYSJ; Homeobox protein knotted-1-like 3
TrEMBLM8B2X11e-116M8B2X1_AEGTA; Homeobox protein knotted-1-like protein 3
STRINGEMT079551e-117(Aegilops tauschii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP56438169
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62990.12e-87KNOTTED-like homeobox of Arabidopsis thaliana 7