PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT04618
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family MYB
Protein Properties Length: 220aa    MW: 24479 Da    PI: 8.2177
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT04618genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding37.74.6e-12246448
                     S-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  4 WTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     WT+ Ed+ll + v + Gg+  W++I r ++ gR  k+c++rw ++l
         EMT04618  2 WTKREDDLLREQVCRCGGPhKWDSICRGLP-GRNSKSCRLRWCQHL 46
                     ******************************.***********9986 PP

2Myb_DNA-binding42.81.2e-136099647
                     HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  6 teEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                      eEd l+v++ + +G++ W+tIa+ +  gRt++ +k+rw+++
         EMT04618 60 REEDMLIVKYQATYGNR-WSTIAEFLS-GRTDNAIKNRWNSV 99
                     69***************.*********.***********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.79E-24199IPR009057Homeodomain-like
PROSITE profilePS5129417.908150IPR017930Myb domain
PfamPF002497.3E-10246IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.1E-14253IPR009057Homeodomain-like
SMARTSM007173.4E-5248IPR001005SANT/Myb domain
CDDcd001671.07E-9246No hitNo description
PROSITE profilePS5129415.83152104IPR017930Myb domain
SMARTSM007177.4E-1354102IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-1757100IPR009057Homeodomain-like
CDDcd001675.27E-1157100No hitNo description
PfamPF002492.3E-1160100IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 220 aa     Download sequence    Send to blast
MWTKREDDLL REQVCRCGGP HKWDSICRGL PGRNSKSCRL RWCQHLDPRV EAVNVKPFPR  60
EEDMLIVKYQ ATYGNRWSTI AEFLSGRTDN AIKNRWNSVL HKHAPSLQVQ GHTRPWAPST  120
ARQAASPEVT PGCLPLFPLA SGDVRMSPRL TEVVSEAETS AAARECLELF PLAPGDIRGN  180
AGAAALSDMS CGAGDPLTEL RLWLAARVVF DVMPLQAYQM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3zqc_A4e-2221025101MYB3
3zqc_D4e-2221025101MYB3
3zqc_G4e-2221025101MYB3
3zqc_J4e-2221025101MYB3
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF9519191e-121JF951919.1 Triticum aestivum clone TaMYB21 R2R3-MYB protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020198738.11e-159transcription factor MYB44-like, partial
TrEMBLM8BCX61e-162M8BCX6_AEGTA; Transcription factor MYB44
STRINGEMT046181e-163(Aegilops tauschii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP49603465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50060.12e-31myb domain protein 77