PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EMT02326 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
|
||||||||
Family | TALE | ||||||||
Protein Properties | Length: 148aa MW: 16755.9 Da PI: 8.6933 | ||||||||
Description | TALE family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 31.2 | 3.8e-10 | 79 | 112 | 22 | 55 |
SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS Homeobox 22 nrypsaeereeLAkklgLterqVkvWFqNrRake 55 +yp++e++ +LA+ +gL+ +q+ +WF N+R ++ EMT02326 79 WPYPTEEDKVRLAAMTGLDPKQINNWFINQRKRH 112 59*****************************985 PP | |||||||
2 | ELK | 34.5 | 4.4e-12 | 32 | 53 | 1 | 22 |
ELK 1 ELKhqLlrKYsgyLgsLkqEFs 22 ELK++Ll+KYsg+L+ L++EF+ EMT02326 32 ELKEMLLKKYSGCLSRLRSEFL 53 9********************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51213 | 10.423 | 32 | 52 | IPR005539 | ELK domain |
Pfam | PF03789 | 5.2E-9 | 32 | 53 | IPR005539 | ELK domain |
SMART | SM01188 | 3.6E-6 | 32 | 53 | IPR005539 | ELK domain |
PROSITE profile | PS50071 | 12.519 | 52 | 115 | IPR001356 | Homeobox domain |
SuperFamily | SSF46689 | 1.5E-20 | 54 | 124 | IPR009057 | Homeodomain-like |
SMART | SM00389 | 3.3E-14 | 54 | 119 | IPR001356 | Homeobox domain |
Gene3D | G3DSA:1.10.10.60 | 3.6E-27 | 57 | 117 | IPR009057 | Homeodomain-like |
CDD | cd00086 | 6.24E-13 | 64 | 116 | No hit | No description |
Pfam | PF05920 | 1.6E-17 | 72 | 111 | IPR008422 | Homeobox KN domain |
PROSITE pattern | PS00027 | 0 | 90 | 113 | IPR017970 | Homeobox, conserved site |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 148 aa Download sequence Send to blast |
MVGSSEDEPC SGDADGSDAG MQEHSSRLAD HELKEMLLKK YSGCLSRLRS EFLKKRKKGK 60 LPKDARLALM DWWNTHYRWP YPTEEDKVRL AAMTGLDPKQ INNWFINQRK RHWKPSEDMR 120 FALMEGVTGG GGSSSGTTLY FDTGTIGP |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 47 | 56 | LRSEFLKKRK |
2 | 53 | 57 | KKRKK |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that may be involved in shoot formation during embryogenesis. {ECO:0000269|PubMed:10080693}. | |||||
UniProt | Probable transcription factor that may be involved in shoot formation during embryogenesis. {ECO:0000269|PubMed:10080693, ECO:0000269|PubMed:10488233}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AB465042 | 0.0 | AB465042.1 Triticum aestivum WLG4 mRNA for KN1-type homeobox transcription factor, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020178258.1 | 1e-107 | homeobox protein knotted-1-like 10 | ||||
Swissprot | A2Y007 | 2e-89 | KNOSA_ORYSI; Homeobox protein knotted-1-like 10 | ||||
Swissprot | Q7GDL5 | 2e-89 | KNOSA_ORYSJ; Homeobox protein knotted-1-like 10 | ||||
TrEMBL | A0A452XVK0 | 1e-107 | A0A452XVK0_AEGTS; Uncharacterized protein | ||||
STRING | Traes_1AS_1B1587F7D.1 | 1e-108 | (Triticum aestivum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1698 | 38 | 92 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G23380.1 | 2e-39 | KNOTTED1-like homeobox gene 6 |