PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_011402196.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Trebouxiophyceae; Chlorellales; Chlorellaceae; Auxenochlorella
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 104aa MW: 11065.5 Da PI: 4.7727 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 50.7 | 4.3e-16 | 2 | 83 | 3 | 84 |
NF-YB 3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplk 84 ++d lP + +++ +k +lP ++s da +++ c ef+ +++s+a+ ++r kr ti++d ++ al +lGfe v p++ XP_011402196.1 2 DEDVSLPRTTIQKAVKGALPPGLRVSWDAIDVLTSCCNEFVHLISSQANVISERTKRSTITPDHVIQALEELGFETLVGPVQ 83 67999************************************************************************99986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 9.7E-27 | 2 | 83 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 5.35E-24 | 3 | 84 | IPR009072 | Histone-fold |
Pfam | PF00808 | 6.8E-14 | 6 | 70 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 104 aa Download sequence Send to blast |
MDEDVSLPRT TIQKAVKGAL PPGLRVSWDA IDVLTSCCNE FVHLISSQAN VISERTKRST 60 ITPDHVIQAL EELGFETLVG PVQEGEGLGS VVKGNHATAG VWAA |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1jfi_B | 2e-23 | 2 | 84 | 11 | 92 | Transcription Regulator NC2 beta chain |
Search in ModeBase |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011402196.1 | 2e-71 | Protein Dr1 | ||||
TrEMBL | A0A087STT9 | 5e-70 | A0A087STT9_AUXPR; Protein Dr1 | ||||
STRING | A0A087STT9 | 8e-71 | (Auxenochlorella protothecoides) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Chlorophytae | OGCP2422 | 15 | 15 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G23090.2 | 9e-23 | nuclear factor Y, subunit B13 |
Link Out ? help Back to Top | |
---|---|
Entrez Gene | 23616890 |