PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_011401194.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Trebouxiophyceae; Chlorellales; Chlorellaceae; Auxenochlorella
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 175aa MW: 19421.1 Da PI: 11.6217 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 38.3 | 3e-12 | 14 | 49 | 12 | 48 |
HHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 12 lvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 l ++v+ +G g W+tIar + gRt+kqc++rw ++l XP_011401194.1 14 LRRLVQAHGEGPWSTIARAFE-GRTGKQCRERWANHL 49 6789*****************.***********9996 PP | |||||||
2 | Myb_DNA-binding | 55.9 | 1e-17 | 55 | 97 | 1 | 45 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 rg+W +eE++++vd+++ G++ W+ Ia++++ gRt++ +k++w+ XP_011401194.1 55 RGAWREEEELRFVDCHRTVGNR-WADIAKRIP-GRTENAVKNHWN 97 89********************.*********.***********8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 8.583 | 1 | 49 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 2.79E-24 | 13 | 96 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.52E-10 | 14 | 49 | No hit | No description |
SMART | SM00717 | 8.8E-4 | 14 | 51 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 4.7E-20 | 14 | 55 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 8.6E-10 | 14 | 49 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 24.334 | 50 | 104 | IPR017930 | Myb domain |
SMART | SM00717 | 1.6E-14 | 54 | 102 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.2E-15 | 55 | 97 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.5E-19 | 56 | 103 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 7.26E-12 | 57 | 100 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0010439 | Biological Process | regulation of glucosinolate biosynthetic process | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:1904095 | Biological Process | negative regulation of endosperm development | ||||
GO:2000692 | Biological Process | negative regulation of seed maturation | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 175 aa Download sequence Send to blast |
MPSHHPTLNA SLPLRRLVQA HGEGPWSTIA RAFEGRTGKQ CRERWANHLR PNIRRGAWRE 60 EEELRFVDCH RTVGNRWADI AKRIPGRTEN AVKNHWNATL RRKPCSAPGG RDTLLKRYMG 120 CTTGQSIGSL PQDGADDSFL TPTVSLLLPA GLLSPTERGR LGPGPLSPPS RPSRA |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1mse_C | 4e-33 | 16 | 103 | 17 | 104 | C-Myb DNA-Binding Domain |
1msf_C | 4e-33 | 16 | 103 | 17 | 104 | C-Myb DNA-Binding Domain |
Search in ModeBase |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00385 | DAP | Transfer from AT3G27785 | Download |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | - | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011401194.1 | 1e-125 | Transcription factor MYB98 | ||||
TrEMBL | A0A087SR27 | 1e-123 | A0A087SR27_AUXPR; Transcription factor MYB98 | ||||
STRING | A0A087SR27 | 1e-124 | (Auxenochlorella protothecoides) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Chlorophytae | OGCP15 | 16 | 114 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G27785.1 | 8e-39 | myb domain protein 118 |
Link Out ? help Back to Top | |
---|---|
Entrez Gene | 23618339 |