PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_011396982.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Trebouxiophyceae; Chlorellales; Chlorellaceae; Auxenochlorella
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 121aa MW: 13434.3 Da PI: 5.2722 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 173.6 | 2.1e-54 | 13 | 107 | 2 | 96 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelege 96 +eqdrflPian+sr mkk lPanaki+kdake+vqecvsefisf+tseasdkcqrekrkti+gddllwa++tlGf+dy+eplk+yl+k+re+e++ XP_011396982.1 13 KEQDRFLPIANISRNMKKFLPANAKIAKDAKESVQECVSEFISFITSEASDKCQREKRKTITGDDLLWAMCTLGFDDYIEPLKLYLAKFREAEKQ 107 89*****************************************************************************************9986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 1.9E-51 | 8 | 114 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 9.94E-39 | 15 | 119 | IPR009072 | Histone-fold |
Pfam | PF00808 | 6.8E-25 | 18 | 82 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 1.2E-19 | 46 | 64 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 49 | 65 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 1.2E-19 | 65 | 83 | No hit | No description |
PRINTS | PR00615 | 1.2E-19 | 84 | 102 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 121 aa Download sequence Send to blast |
MADNSGDEGM GSKEQDRFLP IANISRNMKK FLPANAKIAK DAKESVQECV SEFISFITSE 60 ASDKCQREKR KTITGDDLLW AMCTLGFDDY IEPLKLYLAK FREAEKQALA AAGKLPNAGH 120 D |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5g49_A | 4e-47 | 10 | 103 | 4 | 97 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011396982.1 | 1e-85 | Nuclear transcription factor Y subunit B-3 | ||||
Swissprot | O23310 | 2e-57 | NFYB3_ARATH; Nuclear transcription factor Y subunit B-3 | ||||
TrEMBL | A0A087SEE2 | 2e-84 | A0A087SEE2_AUXPR; Nuclear transcription factor Y subunit B-3 | ||||
STRING | A0A087SEE2 | 4e-85 | (Auxenochlorella protothecoides) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Chlorophytae | OGCP2023 | 16 | 16 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G14540.1 | 1e-59 | nuclear factor Y, subunit B3 |
Link Out ? help Back to Top | |
---|---|
Entrez Gene | 23612752 |
Publications ? help Back to Top | |||
---|---|---|---|
|