PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 899639 | ||||||||
Common Name | ARALYDRAFT_899639 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | Whirly | ||||||||
Protein Properties | Length: 75aa MW: 8364.71 Da PI: 9.1198 | ||||||||
Description | Whirly family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Whirly | 41.5 | 2.6e-13 | 2 | 44 | 21 | 63 |
Whirly 21 ldsgnlklkraGglllelanataerkydWekkqsfalsateva 63 +ds+++kl+++G+lll++a+++++r+y+W+kkq++ t + 899639 2 DDSEAFKLSKDGFLLLQFAPSAGVRQYNWGKKQVWFYLLTSYG 44 69*******************************9876666555 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF54447 | 3.06E-8 | 3 | 46 | IPR009044 | ssDNA-binding transcriptional regulator |
Gene3D | G3DSA:2.30.31.10 | 3.0E-12 | 3 | 55 | IPR009044 | ssDNA-binding transcriptional regulator |
Pfam | PF08536 | 3.0E-10 | 3 | 37 | IPR013742 | Plant transcription factor |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 75 aa Download sequence Send to blast |
MDDSEAFKLS KDGFLLLQFA PSAGVRQYNW GKKQVWFYLL TSYGPLSCNL VKTISLDLVL 60 KDSLFSGHLF SLSK* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4koo_A | 2e-14 | 3 | 46 | 35 | 78 | Single-stranded DNA-binding protein WHY1, chloroplastic |
4koo_B | 2e-14 | 3 | 46 | 35 | 78 | Single-stranded DNA-binding protein WHY1, chloroplastic |
4koo_C | 2e-14 | 3 | 46 | 35 | 78 | Single-stranded DNA-binding protein WHY1, chloroplastic |
4koo_D | 2e-14 | 3 | 46 | 35 | 78 | Single-stranded DNA-binding protein WHY1, chloroplastic |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Single-stranded DNA-binding protein that functions in both chloroplasts and nucleus. In chloroplasts, maintains plastid genome stability by preventing break-induced and short homology-dependent illegitimate recombinations. In nucleus, modulates telomere length homeostasis by inhibiting the action of the telomerase at the extreme termini of chromosomes. Is recruited to a distal element upstream of the kinesin KP1 to mediate the transcriptional repression of KP1. Is required for full salicylic acid-dependent plant disease resistance responses. Can bind double-stranded DNA in vivo. {ECO:0000269|PubMed:14960277, ECO:0000269|PubMed:17217467, ECO:0000269|PubMed:19666500, ECO:0000269|PubMed:19669906, ECO:0000269|PubMed:20551348, ECO:0000269|PubMed:21911368}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 899639 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By salicylic acid (SA) and infection by H.parasitica. {ECO:0000269|PubMed:14960277, ECO:0000269|PubMed:19669906}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | CP002684 | 5e-60 | CP002684.1 Arabidopsis thaliana chromosome 1 sequence. | |||
GenBank | F14L17 | 5e-60 | AC012188.2 Sequence of BAC F14L17 from Arabidopsis thaliana chromosome 1, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Swissprot | Q9M9S3 | 7e-14 | WHY1_ARATH; Single-stranded DNA-binding protein WHY1, chloroplastic | ||||
TrEMBL | D7L115 | 9e-46 | D7L115_ARALL; Uncharacterized protein | ||||
STRING | scaffold_303609.1 | 1e-46 | (Arabidopsis lyrata) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G14410.1 | 3e-16 | ssDNA-binding transcriptional regulator |
Link Out ? help Back to Top | |
---|---|
Phytozome | 899639 |
Entrez Gene | 9321976 |