PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 492601 | ||||||||
Common Name | ARALYDRAFT_492601 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 268aa MW: 30174.7 Da PI: 5.5916 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 47.8 | 3.4e-15 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd++l++ + G +W++ ++ g++R++k+c++rw +yl 492601 14 KGPWTAEEDKKLINFILTNGHCCWRALPKLAGLRRCGKSCRLRWTNYL 61 79********************************************97 PP | |||||||
2 | Myb_DNA-binding | 51.5 | 2.4e-16 | 71 | 111 | 5 | 47 |
-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 + +E++l +d+++ lG++ W++Ia++++ gRt++++k++w+++ 492601 71 SHDEEQLVIDLHAHLGNK-WSKIASRLP-GRTDNEIKNHWNTH 111 789***************.*********.************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 6.7E-21 | 5 | 62 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 12.915 | 9 | 61 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 9.39E-27 | 11 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 6.2E-12 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 7.0E-14 | 14 | 61 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 5.69E-9 | 16 | 61 | No hit | No description |
PROSITE profile | PS51294 | 27.371 | 62 | 116 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.6E-24 | 63 | 116 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 3.8E-14 | 66 | 114 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.2E-14 | 71 | 111 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 8.17E-11 | 71 | 112 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:2000652 | Biological Process | regulation of secondary cell wall biogenesis | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 268 aa Download sequence Send to blast |
MGRQPCCDKL GVKKGPWTAE EDKKLINFIL TNGHCCWRAL PKLAGLRRCG KSCRLRWTNY 60 LRPDLKRGLL SHDEEQLVID LHAHLGNKWS KIASRLPGRT DNEIKNHWNT HIKKKLLKMG 120 IDPMTHQPLP QEPSNIGNSK TISSNPADAI SVEPKTTNTK DVEISGTTTE EESSSTVTDQ 180 NSSMDSENHL IDNIYNDDEL FSYLWSDETT KAEASWSDSN FGVGGTLYDN NISGADADFP 240 IWSPERINDE KMFLDYCQDF GVHDFGF* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 7e-27 | 14 | 116 | 7 | 108 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | R2R3 MYB-type transcription factor controlling the production of volatile benzoides in flowers by regulating the shikimate pathway, namely by activation of the 5-enol-pyruvylshikimate-3-phosphate synthase gene. This scent, mostly produced in the evening and night by the petals, attracts the pollinators. Anthocyanins production is not controlled by ODO1 as color and scent are produced at different stages of development. {ECO:0000269|PubMed:15805488}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 492601 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Increases before the onset of volatile emission at the end of the light period, peaks at night and decreases when volatile emission declines early morning. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AF175993 | 0.0 | AF175993.2 Arabidopsis thaliana putative transcription factor (MYB85) mRNA, complete cds. | |||
GenBank | AK175718 | 0.0 | AK175718.1 Arabidopsis thaliana mRNA for myb-like protein, complete cds, clone: RAFL22-25-P15. | |||
GenBank | AK175777 | 0.0 | AK175777.1 Arabidopsis thaliana mRNA for myb-like protein, complete cds, clone: RAFL22-35-I17. | |||
GenBank | AY519608 | 0.0 | AY519608.1 Arabidopsis thaliana MYB transcription factor (At4g22680) mRNA, complete cds. | |||
GenBank | DQ446863 | 0.0 | DQ446863.1 Arabidopsis thaliana clone pENTR221-At4g22680 myb family transcription factor (At4g22680) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020873672.1 | 0.0 | protein ODORANT1 | ||||
Swissprot | Q50EX6 | 7e-92 | ODO1_PETHY; Protein ODORANT1 | ||||
TrEMBL | D7ME18 | 0.0 | D7ME18_ARALL; Uncharacterized protein | ||||
STRING | fgenesh2_kg.7__2034__AT4G22680.1 | 0.0 | (Arabidopsis lyrata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G22680.1 | 1e-177 | myb domain protein 85 |
Link Out ? help Back to Top | |
---|---|
Phytozome | 492601 |
Entrez Gene | 9303829 |
Publications ? help Back to Top | |||
---|---|---|---|
|