PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 488432
Common NameARALYDRAFT_488432
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family CO-like
Protein Properties Length: 349aa    MW: 38727 Da    PI: 6.8197
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
488432genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box18.73.7e-061152540
  zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40
               C+++ +   + +C+ ++ +lC +C  + H        H++v
    488432 11 ACDTCRSAACTVYCRADSAYLCTSCDAQVHAAnrlasrHERV 52
              6******99*********************556788888776 PP

2zf-B_box377.2e-125297342
  zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
               r+C+ +e+ ++ +fC+ +   lC +C +e+H+       H++vp+
    488432 52 VRVCQSCERAPAAFFCKADAASLCTTCDSEIHSAnplarrHQRVPI 97
              689*****************************66899999**9997 PP

3CCT66.48.2e-23279323145
     CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqae 45 
             Rea++lRY+eK+k RkFeK+irY+sRKa+Ae+RpR+KGrF+k++e
  488432 279 REARVLRYREKKKMRKFEKTIRYASRKAYAEKRPRIKGRFAKRNE 323
             9*****************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003361.9E-8754IPR000315B-box-type zinc finger
PROSITE profilePS5011910.7221254IPR000315B-box-type zinc finger
CDDcd000212.62E-71254No hitNo description
PROSITE profilePS5011912.3585097IPR000315B-box-type zinc finger
PfamPF006433.2E-95297IPR000315B-box-type zinc finger
CDDcd000211.08E-85397No hitNo description
SMARTSM003367.1E-135597IPR000315B-box-type zinc finger
PfamPF062037.4E-17279321IPR010402CCT domain
PROSITE profilePS5101716.559279321IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0009909Biological Processregulation of flower development
GO:0005622Cellular Componentintracellular
GO:0008270Molecular Functionzinc ion binding
GO:0042802Molecular Functionidentical protein binding
Sequence ? help Back to Top
Protein Sequence    Length: 349 aa     Download sequence    Send to blast
MMKVESNWGQ ACDTCRSAAC TVYCRADSAY LCTSCDAQVH AANRLASRHE RVRVCQSCER  60
APAAFFCKAD AASLCTTCDS EIHSANPLAR RHQRVPILPI SENSYSSTAT NHSCETTVTD  120
PENRLVLGQG EEDEDEAEAA SWLLPNSGKN NGNNNGFSIG DEFLDLVDYS SSDKQFTDQS  180
NQYQLDCNVP QRSYEDGVVP LQVEVSKGHM NHEQQNFQLS ITCGSPRAHR SSNGSLSHMV  240
HVSSIDLGVV PESTNPRSPK AVTDQLPDPP AQMLSPRDRE ARVLRYREKK KMRKFEKTIR  300
YASRKAYAEK RPRIKGRFAK RNEVDAEANE AFSTIITFDT GYGIVPSF*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1286292REKKKMR
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor that may be involved in the light input to the circadian clock but does not affect flowering time.
Cis-element ? help Back to Top
SourceLink
PlantRegMap488432
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Expressed with a circadian rhythm showing a peak at dawn.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0743690.0AY074369.1 Arabidopsis thaliana putative CONSTANS 1 protein (At5g15850) mRNA, complete cds.
GenBankBT0023630.0BT002363.1 Arabidopsis thaliana clone U10630 putative CONSTANS 1 protein (At5g15850) mRNA, complete cds.
GenBankY105550.0Y10555.1 A.thaliana mRNA for CONSTANS like 1 (COL1) protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002873745.10.0zinc finger protein CONSTANS-LIKE 1
SwissprotO500550.0COL1_ARATH; Zinc finger protein CONSTANS-LIKE 1
TrEMBLD7M7G90.0D7M7G9_ARALL; Uncharacterized protein
STRINGfgenesh2_kg.6__1566__AT5G15850.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM21282670
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15850.10.0CONSTANS-like 1
Publications ? help Back to Top
  1. Simon S,Rühl M,de Montaigu A,Wötzel S,Coupland G
    Evolution of CONSTANS Regulation and Function after Gene Duplication Produced a Photoperiodic Flowering Switch in the Brassicaceae.
    Mol. Biol. Evol., 2015. 32(9): p. 2284-301
    [PMID:25972346]
  2. An C, et al.
    Mediator subunit MED25 links the jasmonate receptor to transcriptionally active chromatin.
    Proc. Natl. Acad. Sci. U.S.A., 2017. 114(42): p. E8930-E8939
    [PMID:28973940]
  3. Ordoñez-Herrera N, et al.
    The Transcription Factor COL12 Is a Substrate of the COP1/SPA E3 Ligase and Regulates Flowering Time and Plant Architecture.
    Plant Physiol., 2018. 176(2): p. 1327-1340
    [PMID:29187570]