PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 481955 | ||||||||
Common Name | ARALYDRAFT_481955 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 85aa MW: 10464 Da PI: 9.2298 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 22.8 | 2.2e-07 | 35 | 74 | 4 | 45 |
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 +T++E++l+ + ++ G + W++Iar++ gR + ++ +w 481955 35 MTEQEEDLIFRMYRLVGDR-WDLIARRVV-GREAMEIERYWI 74 7****************99.*********.*******99995 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00717 | 1.4E-5 | 31 | 79 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 3.55E-5 | 34 | 73 | No hit | No description |
Pfam | PF00249 | 2.2E-6 | 35 | 74 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.3E-8 | 35 | 74 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 1.12E-6 | 36 | 74 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:2000039 | Biological Process | regulation of trichome morphogenesis | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 85 aa Download sequence Send to blast |
MDNTNRLRRL QGRKQPKFTH NSEEVCSMKW EFINMTEQEE DLIFRMYRLV GDRWDLIARR 60 VVGREAMEIE RYWIMRNSDF FSQK* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | MYB-type transcription factor involved in trichome cell specification. Acts as a negative regulator of trichome patterning and formation by direct binding to the cis-acting regulatory elements of GL1, thus suppressing the expression of GL1. {ECO:0000269|PubMed:17933793}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 481955 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | DQ108777 | 1e-102 | DQ108777.1 Arabidopsis thaliana clone 22671 mRNA sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020885158.1 | 9e-57 | MYB-like transcription factor TCL1 | ||||
Swissprot | D3GKW6 | 4e-50 | TCL1_ARATH; MYB-like transcription factor TCL1 | ||||
TrEMBL | D7LC52 | 2e-55 | D7LC52_ARALL; DNA binding protein | ||||
STRING | fgenesh2_kg.4__1015__AT2G30432.1 | 3e-56 | (Arabidopsis lyrata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM323 | 28 | 194 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G30432.1 | 2e-52 | MYB_related family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | 481955 |
Entrez Gene | 9317177 |
Publications ? help Back to Top | |||
---|---|---|---|
|