PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 479155 | ||||||||
Common Name | ARALYDRAFT_479155 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | GATA | ||||||||
Protein Properties | Length: 176aa MW: 19043.2 Da PI: 8.891 | ||||||||
Description | GATA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GATA | 57.6 | 1.7e-18 | 43 | 77 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 C+ Cgt+ TplWR gp g+k+LCnaCG++ rkk++ 479155 43 CVDCGTIRTPLWRGGPAGPKSLCNACGIKSRKKRQ 77 *********************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF57716 | 1.95E-12 | 36 | 77 | No hit | No description |
PROSITE profile | PS50114 | 12.202 | 37 | 73 | IPR000679 | Zinc finger, GATA-type |
SMART | SM00401 | 2.0E-12 | 37 | 92 | IPR000679 | Zinc finger, GATA-type |
Gene3D | G3DSA:3.30.50.10 | 6.1E-15 | 41 | 77 | IPR013088 | Zinc finger, NHR/GATA-type |
CDD | cd00202 | 5.80E-12 | 42 | 92 | No hit | No description |
Pfam | PF00320 | 3.0E-16 | 43 | 77 | IPR000679 | Zinc finger, GATA-type |
PROSITE pattern | PS00344 | 0 | 43 | 68 | IPR000679 | Zinc finger, GATA-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0008270 | Molecular Function | zinc ion binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 176 aa Download sequence Send to blast |
MSEGSEETKT KVDSAGELSD VDNENCSSSG SGGGSSGDTK RTCVDCGTIR TPLWRGGPAG 60 PKSLCNACGI KSRKKRQAAL GMRSEEKKKN RKSSGNDLNL DHRNAKNDKI NKDDDAKNDK 120 INKDDDAKND KINKDDDLKT CNSKTVEKKR LWRKLGEEER AAVLLMALSC SSVYA* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional regulator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 479155 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK229178 | 1e-136 | AK229178.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL16-46-O07. | |||
GenBank | BT010844 | 1e-136 | BT010844.1 Arabidopsis thaliana At3g16870 mRNA, complete cds. | |||
GenBank | BT012611 | 1e-136 | BT012611.1 Arabidopsis thaliana At1g35180 gene, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020889225.1 | 1e-105 | LOW QUALITY PROTEIN: GATA transcription factor 17 | ||||
Swissprot | Q9LIB5 | 1e-74 | GAT17_ARATH; GATA transcription factor 17 | ||||
TrEMBL | D7L685 | 1e-120 | D7L685_ARALL; Uncharacterized protein | ||||
STRING | fgenesh2_kg.3__1856__AT3G16870.1 | 1e-121 | (Arabidopsis lyrata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM12643 | 15 | 28 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G16870.1 | 9e-60 | GATA transcription factor 17 |
Link Out ? help Back to Top | |
---|---|
Phytozome | 479155 |
Entrez Gene | 9321240 |
Publications ? help Back to Top | |||
---|---|---|---|
|