PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 477472
Common NameARALYDRAFT_477472
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family CO-like
Protein Properties Length: 348aa    MW: 38510.6 Da    PI: 5.8148
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
477472genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box18.83.4e-061456440
  zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40
              r C+++ +   + +Ce ++ +lC +C    H        H++v
    477472 14 RACDTCRSAACTVYCEADSAYLCTTCDARVHAAnrvasrHERV 56
              57******99******************999556677778766 PP

2zf-B_box32.32e-1056101342
  zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42 
                r+C+ +e+ ++ + C+ +   lC  C  e+H+       H++vp+
    477472  56 VRVCQSCESAPAAFLCKADAASLCTACDAEIHSAnplarrHQRVPI 101
               689*****************************66899999**9997 PP

3CCT68.51.8e-23278320143
     CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkq 43 
             Rea++lRY+eK+ktRkF+K+irY+sRKa+Ae RpR+KGrF+k+
  477472 278 REARVLRYREKKKTRKFDKTIRYASRKAYAEIRPRIKGRFAKR 320
             9****************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.7791158IPR000315B-box-type zinc finger
SMARTSM003362.0E-81158IPR000315B-box-type zinc finger
CDDcd000216.20E-81458No hitNo description
PROSITE profilePS5011911.66154101IPR000315B-box-type zinc finger
PfamPF006435.1E-856101IPR000315B-box-type zinc finger
CDDcd000218.56E-957101No hitNo description
SMARTSM003365.0E-1159101IPR000315B-box-type zinc finger
PROSITE profilePS5101716.44278320IPR010402CCT domain
PfamPF062033.2E-17278320IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009658Biological Processchloroplast organization
GO:0009909Biological Processregulation of flower development
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048576Biological Processpositive regulation of short-day photoperiodism, flowering
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MLKEESNESG TWARACDTCR SAACTVYCEA DSAYLCTTCD ARVHAANRVA SRHERVRVCQ  60
SCESAPAAFL CKADAASLCT ACDAEIHSAN PLARRHQRVP ILPLSANSCS SMAASETDAD  120
NDEDDREVAS WLLPNPGKNS GNQNNGFLFG VEYLDLVDYS SSMDNQFEDH QYSHYQRSFG  180
GDGVVPLQVE ESTSHLQQSQ HNFQLGINYG FSSGANYNNN FLKDLNHSAS VSSMDISVVP  240
ESTASDITVQ HPRTTKETTD QLAGPPTQVV QQLTPMEREA RVLRYREKKK TRKFDKTIRY  300
ASRKAYAEIR PRIKGRFAKR IEIEAEAEEI FSTSLMSETG YGIVPSF*
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor. Does not affect flowering time.
Cis-element ? help Back to Top
SourceLink
PlantRegMap477472
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Expressed with a circadian rhythm showing a peak at dawn.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankATHCOL2A0.0L81120.1 Arabidopsis thaliana Landsberg erecta COL2 (CONSTANS) mRNA, complete cds.
GenBankAY0887790.0AY088779.1 Arabidopsis thaliana clone 949 mRNA, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020886912.10.0zinc finger protein CONSTANS-LIKE 2
SwissprotQ965020.0COL2_ARATH; Zinc finger protein CONSTANS-LIKE 2
TrEMBLD7KZG40.0D7KZG4_ARALL; Uncharacterized protein
STRINGfgenesh2_kg.3__173__AT3G02380.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM21282670
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02380.10.0CONSTANS-like 2
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Simon S,Rühl M,de Montaigu A,Wötzel S,Coupland G
    Evolution of CONSTANS Regulation and Function after Gene Duplication Produced a Photoperiodic Flowering Switch in the Brassicaceae.
    Mol. Biol. Evol., 2015. 32(9): p. 2284-301
    [PMID:25972346]