PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 477093 | ||||||||
Common Name | ARALYDRAFT_477093 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | HSF | ||||||||
Protein Properties | Length: 137aa MW: 15704.2 Da PI: 4.8788 | ||||||||
Description | HSF family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | HSF_DNA-bind | 25.7 | 3e-08 | 2 | 39 | 9 | 46 |
HHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHST CS HSF_DNA-bind 9 iledeelkeliswsengnsfvvldeeefakkvLpkyFk 46 +++d++l+ +isws+++nsf+v++ e ++++vLpk + 477093 2 VVDDPSLDPIISWSKSNNSFIVWNLEGLHREVLPKSIE 39 6899*****************************99654 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF46785 | 1.07E-7 | 2 | 56 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
Pfam | PF00447 | 1.4E-6 | 2 | 54 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Gene3D | G3DSA:1.10.10.10 | 2.5E-8 | 2 | 54 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0016021 | Cellular Component | integral component of membrane | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 137 aa Download sequence Send to blast |
MVVDDPSLDP IISWSKSNNS FIVWNLEGLH REVLPKSIEF GKHYLKFMTE LKFYVSFIYF 60 GIVSHLVFVV VDRALEELRG QSNGNLDMSI FFIYVYICKD YISEFGIVSH LVFVVVDRAL 120 EELRGQSNGN LDMSIL* |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 477093 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK226945 | 6e-58 | AK226945.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL09-28-L17. | |||
GenBank | CP002684 | 6e-58 | CP002684.1 Arabidopsis thaliana chromosome 1 sequence. | |||
GenBank | YUP8H12R | 6e-58 | AC002986.1 Arabidopsis thaliana chromosome 1 YAC YUP8H12R sequence, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
TrEMBL | D7KVZ6 | 3e-93 | D7KVZ6_ARALL; Uncharacterized protein | ||||
STRING | fgenesh2_kg.2__2223__AT1G79245.1 | 6e-94 | (Arabidopsis lyrata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM3839 | 14 | 57 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G77570.1 | 3e-14 | Winged helix-turn-helix transcription repressor DNA-binding |
Link Out ? help Back to Top | |
---|---|
Phytozome | 477093 |
Entrez Gene | 9325301 |