PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 470636 | ||||||||
Common Name | ARALYDRAFT_470636 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 244aa MW: 27755.9 Da PI: 6.3457 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 54 | 3.7e-17 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+W++eEd +l++++ ++G ++W++ ++ g+ R++k+c++rw +yl 470636 14 KGPWSAEEDRILINYISLHGHPNWRALPKLAGLLRCGKSCRLRWINYL 61 79******************************99************97 PP | |||||||
2 | Myb_DNA-binding | 51.2 | 2.9e-16 | 67 | 112 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg++T+ E++ ++++++ lG++ W++Ia++++ gRt++++k+ w+++l 470636 67 RGNFTPHEEDTIINLHQILGNR-WSAIAAKLP-GRTDNEIKNVWHTHL 112 89********************.*********.************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 4.9E-24 | 5 | 64 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 16.639 | 9 | 61 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 6.47E-30 | 11 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 7.7E-14 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 4.6E-15 | 14 | 61 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 3.75E-10 | 16 | 61 | No hit | No description |
PROSITE profile | PS51294 | 23.384 | 62 | 116 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.2E-26 | 65 | 116 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 8.2E-14 | 66 | 114 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.8E-14 | 67 | 112 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 3.62E-9 | 69 | 112 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009651 | Biological Process | response to salt stress | ||||
GO:0009739 | Biological Process | response to gibberellin | ||||
GO:0009751 | Biological Process | response to salicylic acid | ||||
GO:0009753 | Biological Process | response to jasmonic acid | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 244 aa Download sequence Send to blast |
MGRRPCCEKI GLKKGPWSAE EDRILINYIS LHGHPNWRAL PKLAGLLRCG KSCRLRWINY 60 LRPDIKRGNF TPHEEDTIIN LHQILGNRWS AIAAKLPGRT DNEIKNVWHT HLKKRLHHNQ 120 DQNNKENFAS TTAAERLQQQ SSSSADISEI TTSGNNNDIS NNNKDSATSS EDVLAVIDES 180 FWSEVVLMDC NISGDGEKNE QKIENWEGSL DKNDKGYNHD MEFWFDHLTS SRIVGEICDI 240 SEF* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 4e-25 | 12 | 116 | 5 | 108 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Plays a regulatory role in meristem function. Functions as component of a regulatory network controlling the establishment and/or development of the shoot system by the regulation of apical meristem function (PubMed:9681014). May play a role in tolerance to boric acid (PubMed:16861809). {ECO:0000269|PubMed:16861809, ECO:0000269|PubMed:9681014}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00127 | DAP | Transfer from AT1G06180 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 470636 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by abscisic acid (ABA), drought, light and wounding in leaves. Down-regulated by drought and ABA in roots. {ECO:0000269|PubMed:9681014}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY519550 | 0.0 | AY519550.1 Arabidopsis thaliana MYB transcription factor (At1g06180) mRNA, complete cds. | |||
GenBank | BT025173 | 0.0 | BT025173.1 Arabidopsis thaliana At1g06180 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020870498.1 | 1e-171 | transcription factor MYB14 | ||||
Swissprot | Q9LNC9 | 1e-157 | MYB13_ARATH; Transcription factor MYB13 | ||||
TrEMBL | D7KFB7 | 1e-180 | D7KFB7_ARALL; Uncharacterized protein | ||||
STRING | fgenesh2_kg.1__590__AT1G06180.1 | 0.0 | (Arabidopsis lyrata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G06180.1 | 1e-150 | myb domain protein 13 |
Link Out ? help Back to Top | |
---|---|
Phytozome | 470636 |
Entrez Gene | 9328387 |
Publications ? help Back to Top | |||
---|---|---|---|
|