PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 352841
Common NameARALYDRAFT_352841
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family Nin-like
Protein Properties Length: 694aa    MW: 77012.2 Da    PI: 7.8156
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
352841genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK89.52.8e-28422473152
  RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
             aek+i+l++l+++F++++kdAAk++gvc+T+LKr CRq+GI+RWP+Rkik++
  352841 422 AEKDITLDTLRQHFAGSLKDAAKNIGVCPTTLKRVCRQHGISRWPSRKIKKV 473
             589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.30.450.403.9E-4227335IPR029016GAF domain-like
SuperFamilySSF557813.02E-6227337IPR029016GAF domain-like
PROSITE profilePS5151917.291409493IPR003035RWP-RK domain
PfamPF020424.7E-25426473IPR003035RWP-RK domain
SuperFamilySSF542771.21E-20595686No hitNo description
Gene3DG3DSA:3.10.20.2406.2E-21597683No hitNo description
PROSITE profilePS5174523.791600685IPR000270PB1 domain
SMARTSM006661.6E-25600685IPR000270PB1 domain
PfamPF005641.9E-19601684IPR000270PB1 domain
CDDcd064071.00E-41601683No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006107Biological Processoxaloacetate metabolic process
GO:0006108Biological Processmalate metabolic process
GO:0005515Molecular Functionprotein binding
GO:0050152Molecular Functionomega-amidase activity
Sequence ? help Back to Top
Protein Sequence    Length: 694 aa     Download sequence    Send to blast
MEESNNSAVV DFPDNFMDQL LWEECSWEEE ATQNDQALSS GLKERVACAM GHLQEVMGER  60
ELLIQLWVPV ETRSGRVLST EEQPYSINTF SQSQSLGLYR DASTGYSFAA EVGSEQLVGL  120
PGRVFLRRMP EWTPDVRFFR REEYPRIRYA RRYQVRASLA LPLFQGTSGN CVAVMEMVTT  180
HRNLEYASQL HTICHTLEAF DLRTSQASIV PASLKVTSSS SSSRTEVASI LQGICSSHRL  240
PLAVTWAHQD SSSCLSALIS ASYAADQDSR CFLAACSEHH LLVGEGIAGR AFATKKQCFA  300
TDVAIFSKWS YPLSHYARMF HLHAALAVPI LTRGNRTVQF VVELFFPRDC LDIQTQSLTL  360
ASQLNLRFQS SPHLMVDDNQ IAQQVRDAAT PPLTQEDPKG KQVSFSFSSS SSLENRKRKT  420
KAEKDITLDT LRQHFAGSLK DAAKNIGVCP TTLKRVCRQH GISRWPSRKI KKVGHSLRKL  480
QVVMDSVEGV QGSLHLASFY SSFPQLQSSS SSSFPLINPT QTVHVPPKSP PSSSGSQGSS  540
GSSTCCSSEE QQLGGFENPS LSHPQLLTLS SLHEDQRAVR VTSSLPPLPS STAPRKAKDG  600
MKVKAMFGDS MLRMSLQPHS RLTDLRREIA KRFGMDDVLT SNFSLKYLDD DQEWVLLTCD  660
ADLEECIQVY KSSLKETIRI LVHRPLSLPS FGS*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap352841
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by nitrate. {ECO:0000269|PubMed:15375205}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0695580.0AC069558.5 Genomic Sequence For Arabidopsis thaliana Clone T5G13 From Chromosome IV, complete sequence.
GenBankAL0355380.0AL035538.1 Arabidopsis thaliana DNA chromosome 4, BAC clone F20D10 (ESSA project).
GenBankAL0355390.0AL035539.1 Arabidopsis thaliana DNA chromosome 4, BAC clone F22I13 (ESSA project).
GenBankAL1615930.0AL161593.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 89.
GenBankCP0026870.0CP002687.1 Arabidopsis thaliana chromosome 4 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002866792.10.0protein NLP3
SwissprotQ9SVF10.0NLP3_ARATH; Protein NLP3
TrEMBLD7MEX90.0D7MEX9_ARALL; RWP-RK domain-containing protein
STRINGfgenesh1_pg.C_scaffold_70000140.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM152871718
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38340.10.0Nin-like family protein
Publications ? help Back to Top
  1. Doidy J, et al.
    "Hit-and-Run" transcription: de novo transcription initiated by a transient bZIP1 "hit" persists after the "run".
    BMC Genomics, 2016. 17: p. 92
    [PMID:26843062]