PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 347167 | ||||||||
Common Name | ARALYDRAFT_347167 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 229aa MW: 26421.6 Da PI: 6.9548 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 53 | 7.9e-17 | 16 | 63 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g WT eEd +l d+v +G+g+W++I r+ g++R++k+c++rw +yl 347167 16 KGLWTVEEDNILMDYVLNHGTGQWNRIVRKTGLKRCGKSCRLRWMNYL 63 678*******************************************97 PP | |||||||
2 | Myb_DNA-binding | 60.7 | 3.2e-19 | 69 | 114 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g++T++E++l+++++k+lG++ W++Ia++++ gRt++q+k++w+++l 347167 69 KGNFTEQEEDLIIRLHKLLGNR-WSLIAKRVP-GRTDNQVKNYWNTHL 114 79********************.*********.************996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 17.446 | 11 | 63 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.25E-30 | 14 | 110 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.2E-12 | 15 | 65 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 9.2E-15 | 16 | 63 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.0E-23 | 17 | 70 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.75E-9 | 19 | 63 | No hit | No description |
PROSITE profile | PS51294 | 28.168 | 64 | 118 | IPR017930 | Myb domain |
SMART | SM00717 | 7.9E-19 | 68 | 116 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.8E-18 | 69 | 114 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 9.1E-28 | 71 | 118 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 6.92E-14 | 71 | 114 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0001708 | Biological Process | cell fate specification | ||||
GO:0032880 | Biological Process | regulation of protein localization | ||||
GO:0048629 | Biological Process | trichome patterning | ||||
GO:2000039 | Biological Process | regulation of trichome morphogenesis | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 229 aa Download sequence Send to blast |
MRIRRREEKE NQEYKKGLWT VEEDNILMDY VLNHGTGQWN RIVRKTGLKR CGKSCRLRWM 60 NYLSPNVNKG NFTEQEEDLI IRLHKLLGNR WSLIAKRVPG RTDNQVKNYW NTHLSKKLVG 120 DYSSAVKTTG EDDDSLPSLF ITAATTSSRH HQQENVYENI AKSFDGVVSA SYEDKPKQEL 180 AHNDVLMATT NDPSHYYGNN ALWVHDDDFE LSSLVMMNFA SGDIEYCL* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 5e-29 | 16 | 118 | 7 | 108 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator, when associated with BHLH2/EGL3/MYC146 or BHLH12/MYC1. Involved in epidermal cell fate specification in leaves. Together with TTG1 and GL3, promotes trichome formation and endoreplication. Regulates the production of a signal that induces hair (trichome) precursor cells on leaf primordia to differentiate. Binds to the WER-binding sites (WBS) promoter regions and activates the transcription of target genes (By similarity). {ECO:0000250, ECO:0000269|PubMed:11063707, ECO:0000269|PubMed:12356720, ECO:0000269|PubMed:15361138, ECO:0000269|PubMed:15728674, ECO:0000269|PubMed:9625690}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 347167 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Up-regulated by gibberellins (PubMed:9625690). May be regulated by GEBP and GEBP-like proteins (PubMed:12535344). {ECO:0000269|PubMed:12535344, ECO:0000269|PubMed:9625690}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY519590 | 0.0 | AY519590.1 Arabidopsis thaliana MYB transcription factor (At3g27920) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002877081.1 | 1e-172 | trichome differentiation protein GL1 | ||||
Swissprot | P27900 | 1e-166 | GL1_ARATH; Trichome differentiation protein GL1 | ||||
TrEMBL | D7LPM2 | 1e-171 | D7LPM2_ARALL; Glabrous 1A | ||||
STRING | fgenesh1_pg.C_scaffold_5000559 | 1e-172 | (Arabidopsis lyrata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G27920.1 | 1e-169 | myb domain protein 0 |
Link Out ? help Back to Top | |
---|---|
Phytozome | 347167 |
Entrez Gene | 9313149 |