PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 338787
Common NameARALYDRAFT_338787
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family Nin-like
Protein Properties Length: 279aa    MW: 32328.9 Da    PI: 8.6292
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
338787genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK83.91.5e-26158207352
  RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
             +++s e++++yF++pi++AAkeL++++T+LK++CR++GI+RWPhRk++sl
  338787 158 NSLSREMMKQYFYMPITKAAKELNIGVTLLKKRCRELGIPRWPHRKLTSL 207
             67999******************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151918.656143227IPR003035RWP-RK domain
PfamPF020426.8E-22160207IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MADQKPLMVW SEANNYESFL QEDIFSFLDQ SLSIDPHSSF INPFKDFQTQ TWFSFQDSIV  60
NPISTTFAAD HTFLASLDLE AISSTFSLDI MSGWWNDNNG NYNNQVEPIL DDISRTNTMG  120
DPKMEKILHE DVNTTIKEKT SQKRIIMKRR YREDGDINSL SREMMKQYFY MPITKAAKEL  180
NIGVTLLKKR CRELGIPRWP HRKLTSLNAL ITNLKDLLGN TEGKTPKSKL RNALELLEME  240
KKMIEEVPDL EFGDKTKRLR QACFKAKYKQ RRLFSSSS*
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap338787
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0266401e-165AB026640.1 Arabidopsis thaliana genomic DNA, chromosome 5, TAC clone:K8A10.
GenBankCP0026881e-165CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002888458.10.0protein RKD3
SwissprotQ9FGD10.0RKD3_ARATH; Protein RKD3
TrEMBLD7KT000.0D7KT00_ARALL; Uncharacterized protein
STRINGfgenesh1_pg.C_scaffold_20008860.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM121801932
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66990.11e-168RWP-RK domain-containing protein
Publications ? help Back to Top
  1. Tedeschi F,Rizzo P,Rutten T,Altschmied L,Bäumlein H
    RWP-RK domain-containing transcription factors control cell differentiation during female gametophyte development in Arabidopsis.
    New Phytol., 2017. 213(4): p. 1909-1924
    [PMID:27870062]