PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 319704
Common NameARALYDRAFT_319704
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family ARF
Protein Properties Length: 598aa    MW: 67943.6 Da    PI: 7.2337
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
319704genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B371.11.5e-22126227199
             EEEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
      B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
             f kvlt sd++ +g +++p+k a e+     ++++   ++l   d++g++W++k++yr++++r++lt+GW+ F  +++L +gD++vF   + +++el+v+++r
  319704 126 FTKVLTASDTSVHGGFSVPRKLAIEClppldMSQPLPAQELLTIDLHGNQWRFKHSYRGTPRRHLLTSGWNAFTTSKKLVAGDVIVFL--RGETGELRVGIRR 226
             89****************************9666666679999*********************************************..449999*****99 PP

             S CS
      B3  99 k 99 
             +
  319704 227 A 227
             6 PP

2Auxin_resp98.11.3e-32252331183
  Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                 a+ha++++++F vvY+Pr+  s+F+v+++k+++a+++k+ vG+Rf m+fe+ed+serr+sGt++gv+++++ +W +S+WrsL+
      319704 252 AVHAFNNQCMFIVVYKPRS--SQFIVSYNKFVDAVNNKFNVGSRFTMRFEGEDFSERRYSGTIIGVNNFSS-HWMESEWRSLE 331
                 799***************6..9**********************************************888.*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.1E-36117239IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.62E-29124234IPR015300DNA-binding pseudobarrel domain
CDDcd100172.80E-21125226No hitNo description
SMARTSM010192.2E-20126228IPR003340B3 DNA binding domain
PfamPF023627.0E-20126227IPR003340B3 DNA binding domain
PROSITE profilePS5086313.366126228IPR003340B3 DNA binding domain
PfamPF065073.4E-29252330IPR010525Auxin response factor
PfamPF023094.1E-6508552IPR033389AUX/IAA domain
SuperFamilySSF542772.75E-9514592No hitNo description
PROSITE profilePS5174523.218516597IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 598 aa     Download sequence    Send to blast
MESGNVVNAQ PELSGITIDV SKRYMYEQLW KLCAGPLCDI PKIGEKVYYF PQGHIELIEA  60
YTREELNKIQ PIFDLPSKLQ CRVIAIQLKV EKNSDETYAE ITLMPDTQVV IPTQNDNHYR  120
PLVNSFTKVL TASDTSVHGG FSVPRKLAIE CLPPLDMSQP LPAQELLTID LHGNQWRFKH  180
SYRGTPRRHL LTSGWNAFTT SKKLVAGDVI VFLRGETGEL RVGIRRAGHQ QKNIHSSLIS  240
IDSMRHGVIA SAVHAFNNQC MFIVVYKPRS SQFIVSYNKF VDAVNNKFNV GSRFTMRFEG  300
EDFSERRYSG TIIGVNNFSS HWMESEWRSL EVKWDEFASF PRPDKVSPWD IEHLTPSLNV  360
LRPSLLKNKR SREVNEIGST SSHLLHPILT QGQEIGEPSM TSPMNVFLSY CDEIEDDETP  420
SRMLMSYHVP TMPKLNYNND QMVTPIEENI TTNANASFRL FGVSLATSSV IKDPIEPMES  480
YPKSEISKLC QEKKLGLGQT ITSPREIQSK QFSSTRSCTK VQMQGVPVGR ALDLNVLNGY  540
DHLIIELEKL FDLNGQLQTR NQWKIAFKDN EGNEKLVGDN PWPEFCSMVK KIFIYPK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-12613541355Auxin response factor 1
4ldw_A1e-12613541355Auxin response factor 1
4ldw_B1e-12613541355Auxin response factor 1
4ldx_A1e-12613541355Auxin response factor 1
4ldx_B1e-12613541355Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap319704
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020887824.10.0auxin response factor 22
SwissprotQ9LQE80.0ARFN_ARATH; Putative auxin response factor 14
TrEMBLD7L9F70.0D7L9F7_ARALL; Auxin response factor
STRINGfgenesh1_pm.C_scaffold_30027200.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM12276731
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G35540.10.0auxin response factor 14