PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Araip.KLB3I | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
|
||||||||
Family | CAMTA | ||||||||
Protein Properties | Length: 91aa MW: 10502.2 Da PI: 7.4073 | ||||||||
Description | CAMTA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | CG-1 | 38.7 | 1.8e-12 | 61 | 90 | 74 | 103 |
CG-1 74 KvggvevlycyYahseenptfqrrcywlLe 103 vg+ve l+cyYah e+nptfqrr+yw+L+ Araip.KLB3I 61 NVGTVEGLNCYYAHREQNPTFQRRIYWMLD 90 5899*************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF12036 | 5.2E-9 | 1 | 46 | IPR021910 | Protein of unknown function DUF3522 |
PROSITE profile | PS51437 | 14.37 | 1 | 91 | IPR005559 | CG-1 DNA-binding domain |
Pfam | PF03859 | 5.3E-9 | 61 | 90 | IPR005559 | CG-1 DNA-binding domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 91 aa Download sequence Send to blast |
MDFWLSFMAV ISTFLYLATI DEVFKRAIHT VIAILTALLA ATKATSDATN PCIKYQQIYS 60 NVGTVEGLNC YYAHREQNPT FQRRIYWMLD L |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Araip.KLB3I |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015037 | 8e-44 | AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015961911.1 | 3e-20 | uncharacterized protein LOC107485896 isoform X1 | ||||
Refseq | XP_015961913.1 | 3e-20 | uncharacterized protein LOC107485896 isoform X2 | ||||
TrEMBL | A0A444ZMM5 | 6e-19 | A0A444ZMM5_ARAHY; Uncharacterized protein | ||||
STRING | XP_007139807.1 | 4e-18 | (Phaseolus vulgaris) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G67310.1 | 3e-13 | Calmodulin-binding transcription activator protein with CG-1 and Ankyrin domains |