PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Araip.J7793 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 189aa MW: 21638.4 Da PI: 7.8769 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 65.5 | 9.7e-21 | 13 | 60 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WT+eEd++l+++++ +G+++Wkt+a + g++R++k+c++rw++yl Araip.J7793 13 RGAWTPEEDQKLAQCIEVHGPKRWKTVATKSGLNRCGKSCRLRWLNYL 60 89********************************************97 PP | |||||||
2 | Myb_DNA-binding | 54.4 | 2.8e-17 | 66 | 110 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg+ + eE++l+++++k+lG++ W++Ia++++ gRt++++k++w++ Araip.J7793 66 RGNISDEEEDLIIRLHKLLGNR-WSLIAKRLP-GRTDNEIKNYWNSC 110 7899******************.*********.***********975 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 26.267 | 8 | 64 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 5.08E-30 | 12 | 107 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.5E-16 | 12 | 62 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 8.3E-19 | 13 | 60 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.5E-25 | 14 | 67 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 6.72E-12 | 15 | 60 | No hit | No description |
PROSITE profile | PS51294 | 20.808 | 65 | 115 | IPR017930 | Myb domain |
SMART | SM00717 | 1.6E-14 | 65 | 113 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 9.8E-16 | 66 | 110 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.1E-25 | 68 | 115 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 9.24E-12 | 70 | 108 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 189 aa Download sequence Send to blast |
MEGNGSTKKT YNRGAWTPEE DQKLAQCIEV HGPKRWKTVA TKSGLNRCGK SCRLRWLNYL 60 RPNIKRGNIS DEEEDLIIRL HKLLGNRWSL IAKRLPGRTD NEIKNYWNSC LCKKVNPKDL 120 KPHTSSTTPQ ETRADEGISS ALESGGTGHM EMKFDFNEFF DFSIDEGAYA LDWVNKFLEL 180 DVIPESSTE |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1gv2_A | 1e-31 | 13 | 115 | 4 | 105 | MYB PROTO-ONCOGENE PROTEIN |
1h8a_C | 2e-31 | 12 | 115 | 26 | 128 | MYB TRANSFORMING PROTEIN |
1mse_C | 1e-31 | 13 | 115 | 4 | 105 | C-Myb DNA-Binding Domain |
1msf_C | 1e-31 | 13 | 115 | 4 | 105 | C-Myb DNA-Binding Domain |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator, when associated with BHLH2/EGL3/MYC146 or BHLH12/MYC1. Involved in epidermal cell fate specification in roots and hypocotyl. Together with GL3 or BHLH2, promotes the formation of non-hair developing cells (atrichoblasts) et the N position in root epidermis. Regulates stomata spatial distribution in hypocotyls. Binds to the WER-binding sites (WBS) promoter regions and activates the transcription of target genes such as GL2 and of CPC. {ECO:0000269|PubMed:10589676, ECO:0000269|PubMed:11585796, ECO:0000269|PubMed:14627722, ECO:0000269|PubMed:15361138, ECO:0000269|PubMed:15795220, ECO:0000269|PubMed:16207757}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Araip.J7793 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Transcriptional activation correlates with reduced histone acetylation on H3 and H4 mediated by HDA18 in N cells. Repressed by CPC in hair cells (H position). {ECO:0000269|PubMed:11910008, ECO:0000269|PubMed:16176989}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016200609.1 | 1e-140 | transcription factor WER-like | ||||
Swissprot | Q9SEI0 | 2e-51 | WER_ARATH; Transcription factor WER | ||||
TrEMBL | A0A444WUF7 | 1e-138 | A0A444WUF7_ARAHY; Uncharacterized protein | ||||
STRING | GLYMA05G04900.1 | 2e-86 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF2148 | 32 | 88 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G14750.1 | 9e-54 | myb domain protein 66 |