PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Araip.7J9JU | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
|
||||||||
Family | Dof | ||||||||
Protein Properties | Length: 134aa MW: 14322.9 Da PI: 9.6573 | ||||||||
Description | Dof family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | zf-Dof | 120.6 | 5.7e-38 | 26 | 86 | 2 | 62 |
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 ++++l+cp CdstntkfCyynny+ sqPr+fCk+CrryWt+GG+lr++PvGgg+rkn k+s Araip.7J9JU 26 EQEHLPCPPCDSTNTKFCYYNNYNFSQPRHFCKSCRRYWTHGGTLRDIPVGGGSRKNAKRS 86 57899****************************************************9876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD007478 | 2.0E-28 | 4 | 84 | IPR003851 | Zinc finger, Dof-type |
Pfam | PF02701 | 9.8E-33 | 28 | 84 | IPR003851 | Zinc finger, Dof-type |
PROSITE profile | PS50884 | 28.425 | 30 | 84 | IPR003851 | Zinc finger, Dof-type |
PROSITE pattern | PS01361 | 0 | 32 | 68 | IPR003851 | Zinc finger, Dof-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 134 aa Download sequence Send to blast |
MPSSDSGESR RSAKPHNTSL APPPAEQEHL PCPPCDSTNT KFCYYNNYNF SQPRHFCKSC 60 RRYWTHGGTL RDIPVGGGSR KNAKRSRTVP SASTATTSSS AGAAVTSVSS VTPLTMVPVA 120 GNNHPGAPVQ FDGW |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. Enhances the DNA binding of OBF transcription factors to OCS elements. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Araip.7J9JU |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By auxin and salicylic acid (SA). {ECO:0000269|PubMed:10758484}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KP662922 | 1e-55 | KP662922.1 Cajanus cajan Dof38 (Dof38) gene, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016201769.1 | 1e-91 | dof zinc finger protein DOF3.4 | ||||
Swissprot | Q39088 | 7e-45 | DOF34_ARATH; Dof zinc finger protein DOF3.4 | ||||
TrEMBL | A0A445ACL7 | 7e-93 | A0A445ACL7_ARAHY; Uncharacterized protein | ||||
STRING | XP_007155977.1 | 6e-50 | (Phaseolus vulgaris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF2801 | 31 | 68 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G50410.1 | 4e-44 | OBF binding protein 1 |
Publications ? help Back to Top | |||
---|---|---|---|
|