PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Araip.7I1D0 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
|
||||||||
Family | Dof | ||||||||
Protein Properties | Length: 163aa MW: 18212.5 Da PI: 8.6822 | ||||||||
Description | Dof family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | zf-Dof | 123.6 | 6.6e-39 | 41 | 99 | 2 | 60 |
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 ++k+++cprC+s++tkfCy+nny+++qPr+fCk+C+ryWt+GGalrnvPvG+grrk +k Araip.7I1D0 41 PDKIIACPRCKSMETKFCYFNNYNVNQPRHFCKGCQRYWTAGGALRNVPVGAGRRKANK 99 7899****************************************************876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD007478 | 2.0E-28 | 40 | 97 | IPR003851 | Zinc finger, Dof-type |
Pfam | PF02701 | 3.5E-32 | 43 | 99 | IPR003851 | Zinc finger, Dof-type |
PROSITE profile | PS50884 | 27.997 | 45 | 99 | IPR003851 | Zinc finger, Dof-type |
PROSITE pattern | PS01361 | 0 | 47 | 83 | IPR003851 | Zinc finger, Dof-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0010214 | Biological Process | seed coat development | ||||
GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
GO:1902455 | Biological Process | negative regulation of stem cell population maintenance | ||||
GO:0044212 | Molecular Function | transcription regulatory region DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 163 aa Download sequence Send to blast |
MAQVQENHQG IKLFGATITL DGGDSKEGNK KEEDQTVEKK PDKIIACPRC KSMETKFCYF 60 NNYNVNQPRH FCKGCQRYWT AGGALRNVPV GAGRRKANKL PCRGAVSDGA CLYDETSDDV 120 HKFGLEEGLI LDKWDDVAVP HGDFRQLFPA KRRRSASAPH QGQ |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 92 | 99 | GRRKANKL |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. Acts as a negative regulator in the phytochrome-mediated light responses. Controls phyB-mediated end-of-day response and the phyA-mediated anthocyanin accumulation. Not involved in direct flowering time regulation. {ECO:0000269|PubMed:19619493}. | |||||
UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity). Transcriptional repressor of 'CONSTANS' expression (By similarity). Regulates a photoperiodic flowering response. {ECO:0000250, ECO:0000269|PubMed:19619493}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00166 | DAP | Transfer from AT1G29160 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Araip.7I1D0 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By red or far-red light. Circadian-regulation. The transcript level rises progressively from dawn and decreases during the night. {ECO:0000269|PubMed:19619493}. | |||||
UniProt | INDUCTION: Circadian-regulation. The transcript level rises progressively from dawn and decreases during the night. {ECO:0000269|PubMed:19619493}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016179291.1 | 1e-121 | dof zinc finger protein DOF1.5 | ||||
Refseq | XP_025684134.1 | 1e-121 | dof zinc finger protein DOF1.5 | ||||
Swissprot | O22967 | 7e-51 | CDF4_ARATH; Cyclic dof factor 4 | ||||
Swissprot | P68350 | 9e-51 | DOF15_ARATH; Dof zinc finger protein DOF1.5 | ||||
TrEMBL | A0A444WZ19 | 1e-120 | A0A444WZ19_ARAHY; Uncharacterized protein | ||||
STRING | GLYMA05G29090.1 | 4e-63 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF6483 | 32 | 51 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G34140.1 | 3e-53 | Dof family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|