PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Araip.53MZR | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 160aa MW: 17522.6 Da PI: 5.5977 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 95 | 6.5e-30 | 1 | 79 | 17 | 95 |
NF-YB 17 mkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 m++++P++aki++d+ke+v+ cv efi+ vt ea+ +c e+r+t++++d++wa+++lGf++y+e lk++l++ r + + Araip.53MZR 1 MRQIVPKHAKICDDTKEIVRSCVCEFIGIVTYEANGHCDTEQRRTLAAEDIIWAMSSLGFDNYAELLKAHLSHVRYIGA 79 89**********************************************************************9997765 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF47113 | 4.19E-19 | 1 | 77 | IPR009072 | Histone-fold |
Gene3D | G3DSA:1.10.20.10 | 3.7E-25 | 1 | 79 | IPR009072 | Histone-fold |
Pfam | PF00808 | 2.3E-11 | 1 | 55 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 4.1E-9 | 19 | 37 | No hit | No description |
PRINTS | PR00615 | 4.1E-9 | 38 | 56 | No hit | No description |
PRINTS | PR00615 | 4.1E-9 | 57 | 75 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 160 aa Download sequence Send to blast |
MRQIVPKHAK ICDDTKEIVR SCVCEFIGIV TYEANGHCDT EQRRTLAAED IIWAMSSLGF 60 DNYAELLKAH LSHVRYIGAE AHYTDAPQRP DENVAPPPTP TRGGVGGPTS FVCRSEYDPR 120 ETGKVCGGFR LGGGAWSTSG DNVGGSEFDP LAYLNRDKFL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5g49_A | 1e-24 | 1 | 75 | 22 | 96 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. Plays a role in the regulation of the embryogenesis. Involved in the abscisic acid (ABA) signaling pathway. {ECO:0000269|PubMed:12509518, ECO:0000269|PubMed:17322342}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Araip.53MZR |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016164010.1 | 1e-118 | nuclear transcription factor Y subunit B-6-like | ||||
Refseq | XP_025667362.1 | 1e-118 | nuclear transcription factor Y subunit B-6 | ||||
Swissprot | Q84W66 | 4e-24 | NFYB6_ARATH; Nuclear transcription factor Y subunit B-6 | ||||
TrEMBL | A0A444YFK8 | 1e-117 | A0A444YFK8_ARAHY; Uncharacterized protein |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF30322 | 2 | 2 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G47670.2 | 2e-26 | nuclear factor Y, subunit B6 |