PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Neem_9584_f_1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 88aa MW: 10294.9 Da PI: 10.3591 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 50 | 6.9e-16 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd +l++++k +G +W+ ++ g+ R++k+c++rw++yl Neem_9584_f_1 14 KGAWTAEEDRKLINYIKIYGIWNWTEMPKAAGLLRSGKSCRLRWLNYL 61 79******************99**********99*************7 PP | |||||||
2 | Myb_DNA-binding | 21.6 | 5.1e-07 | 67 | 88 | 1 | 22 |
TSSS-HHHHHHHHHHHHHTTTT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGgg 22 rg++++eEde++++++++lG++ Neem_9584_f_1 67 RGNFSPEEDEIIIKVHEKLGNR 88 89******************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 20.717 | 9 | 65 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.6E-22 | 9 | 64 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 4.6E-12 | 13 | 63 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 1.19E-23 | 15 | 88 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 8.82E-10 | 16 | 61 | No hit | No description |
Pfam | PF13921 | 6.1E-15 | 17 | 76 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 1.1E-10 | 65 | 88 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 10.293 | 66 | 88 | IPR017930 | Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 88 aa Download sequence Send to blast |
MAKVSVYGNT SLRKGAWTAE EDRKLINYIK IYGIWNWTEM PKAAGLLRSG KSCRLRWLNY 60 LRPDIKRGNF SPEEDEIIIK VHEKLGNR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 5e-18 | 9 | 88 | 22 | 100 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that regulates freezing tolerance by affecting expression of CBF genes. {ECO:0000269|PubMed:24415840}. | |||||
UniProt | Transcription factor. {ECO:0000305}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by salicylic acid (SA), jasmonic acid (JA), salt (NaCl), ethylene and auxin (IAA) (PubMed:16463103). Down-regulated by cold treatment (PubMed:24415840). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:24415840}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006449185.2 | 2e-40 | myb-related protein 308 | ||||
Refseq | XP_006467925.1 | 3e-40 | myb-related protein 308-like isoform X1 | ||||
Swissprot | P81395 | 5e-34 | MYB30_ANTMA; Myb-related protein 330 | ||||
Swissprot | Q9SJX8 | 3e-34 | MYB14_ARATH; Transcription factor MYB14 | ||||
TrEMBL | A0A067GJW7 | 3e-40 | A0A067GJW7_CITSI; Uncharacterized protein (Fragment) | ||||
STRING | XP_006467925.1 | 1e-39 | (Citrus sinensis) | ||||
STRING | XP_006449185.1 | 1e-40 | (Citrus clementina) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G31180.1 | 1e-36 | myb domain protein 14 |
Publications ? help Back to Top | |||
---|---|---|---|
|