PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Neem_8798_f_7 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
|
||||||||
Family | Dof | ||||||||
Protein Properties | Length: 159aa MW: 17927.2 Da PI: 9.3004 | ||||||||
Description | Dof family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | zf-Dof | 124.2 | 4.2e-39 | 41 | 99 | 2 | 60 |
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 ++k+++cprC+s++tkfCy+nny+++qPr+fCk+C+ryWt+GGalrnvPvG+grrk k Neem_8798_f_7 41 PDKIIPCPRCKSMETKFCYFNNYNVNQPRHFCKGCQRYWTAGGALRNVPVGAGRRKTKP 99 68999***************************************************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD007478 | 1.0E-29 | 40 | 98 | IPR003851 | Zinc finger, Dof-type |
Pfam | PF02701 | 5.4E-32 | 43 | 98 | IPR003851 | Zinc finger, Dof-type |
PROSITE profile | PS50884 | 28.369 | 45 | 99 | IPR003851 | Zinc finger, Dof-type |
PROSITE pattern | PS01361 | 0 | 47 | 83 | IPR003851 | Zinc finger, Dof-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0010214 | Biological Process | seed coat development | ||||
GO:0044212 | Molecular Function | transcription regulatory region DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 159 aa Download sequence Send to blast |
MANEEQGIKL FGTTITLHGR QVKEEQHNQA DHQDQTLDKR PDKIIPCPRC KSMETKFCYF 60 NNYNVNQPRH FCKGCQRYWT AGGALRNVPV GAGRRKTKPP GRGLGGFPEG CLYDGSAAEV 120 HQFGLDGVVM EEWHMAAHGG FQHVFPVKRR RNNSGGQPY |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. Acts as a negative regulator in the phytochrome-mediated light responses. Controls phyB-mediated end-of-day response and the phyA-mediated anthocyanin accumulation. Not involved in direct flowering time regulation. {ECO:0000269|PubMed:19619493}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00166 | DAP | Transfer from AT1G29160 | Download |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By red or far-red light. Circadian-regulation. The transcript level rises progressively from dawn and decreases during the night. {ECO:0000269|PubMed:19619493}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_022777309.1 | 2e-86 | dof zinc finger protein DOF1.5-like isoform X2 | ||||
Swissprot | P68350 | 1e-63 | DOF15_ARATH; Dof zinc finger protein DOF1.5 | ||||
TrEMBL | A0A2C9U649 | 6e-84 | A0A2C9U649_MANES; Uncharacterized protein | ||||
STRING | cassava4.1_028393m | 7e-85 | (Manihot esculenta) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM2809 | 26 | 69 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G29160.1 | 4e-66 | Dof family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|