PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Neem_39295_f_1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
|
||||||||
Family | ERF | ||||||||
Protein Properties | Length: 173aa MW: 19679.3 Da PI: 9.1826 | ||||||||
Description | ERF family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | AP2 | 62.6 | 8.4e-20 | 67 | 118 | 2 | 55 |
AP2 2 gykGVrwdkkrgrWvAeIrdpsengkrkrfslgkfgtaeeAakaaiaarkkleg 55 +y+GVr+++ +g+++AeIr p++n+ +r++lg++ +e+Aa a+++a+ +++g Neem_39295_f_1 67 KYRGVRRRP-WGKYAAEIRNPKKNN-GARIWLGTYEKPEDAALAYDRAAFEMRG 118 7********.**********99965.5*************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
CDD | cd00018 | 1.18E-30 | 67 | 128 | No hit | No description |
SuperFamily | SSF54171 | 2.03E-21 | 67 | 127 | IPR016177 | DNA-binding domain |
Gene3D | G3DSA:3.30.730.10 | 5.9E-30 | 67 | 127 | IPR001471 | AP2/ERF domain |
PROSITE profile | PS51032 | 23.235 | 67 | 126 | IPR001471 | AP2/ERF domain |
Pfam | PF00847 | 6.6E-14 | 67 | 118 | IPR001471 | AP2/ERF domain |
SMART | SM00380 | 1.8E-36 | 67 | 132 | IPR001471 | AP2/ERF domain |
PRINTS | PR00367 | 1.4E-13 | 68 | 79 | IPR001471 | AP2/ERF domain |
PRINTS | PR00367 | 1.4E-13 | 108 | 128 | IPR001471 | AP2/ERF domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 173 aa Download sequence Send to blast |
MYEENTLFES DLALLDSIRE HLLSDDFESA FSFPAMNFCN SQIKLEPDNE VTQTAAEESR 60 APLKDWKYRG VRRRPWGKYA AEIRNPKKNN GARIWLGTYE KPEDAALAYD RAAFEMRGSK 120 AKLNFPHLIG SNIEPVRVKN KRGCSCSSSS SKALQLQSSE TPKVKRTKML CPN |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
2gcc_A | 7e-28 | 68 | 132 | 6 | 69 | ATERF1 |
3gcc_A | 7e-28 | 68 | 132 | 6 | 69 | ATERF1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Acts as a transcriptional activator. Binds to the GCC-box pathogenesis-related promoter element. Involved in the regulation of gene expression by stress factors and by components of stress signal transduction pathways. {ECO:0000269|PubMed:11950980}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Strongly induced by wounding. Induced by Pseudomonas syringae tomato (both virulent and avirulent avrRpt2 strains), independently of PAD4. Also induced by methyl jasmonate (MeJA) independently of JAR1, but seems to not be affected by ethylene. Induction by salicylic acid (SA) is controlled by growth and/or developmental conditions, and seems to be more efficient and independent of PAD4 in older plants. {ECO:0000269|PubMed:11950980, ECO:0000269|PubMed:12068110}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021280918.1 | 3e-48 | ethylene-responsive transcription factor 2-like | ||||
Swissprot | Q8L9K1 | 2e-39 | ERF99_ARATH; Ethylene-responsive transcription factor 13 | ||||
TrEMBL | A0A2H5NNT0 | 1e-54 | A0A2H5NNT0_CITUN; Uncharacterized protein | ||||
STRING | EOX96461 | 5e-48 | (Theobroma cacao) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM10 | 28 | 1650 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G44840.1 | 4e-41 | ethylene-responsive element binding factor 13 |
Publications ? help Back to Top | |||
---|---|---|---|
|