PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Neem_3912_f_3 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 96aa MW: 11045.9 Da PI: 9.6557 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 60.2 | 4.5e-19 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEde+lv+++k+ G g+W++ ++ g+ R++k+c++rw +yl Neem_3912_f_3 14 KGPWTPEEDEILVEYIKRNGHGSWRSLPKLAGLLRCGKSCRLRWTNYL 61 79******************************99************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 1.3E-26 | 5 | 64 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 24.82 | 9 | 65 | IPR017930 | Myb domain |
SMART | SM00717 | 5.5E-14 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.6E-17 | 14 | 61 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 7.18E-25 | 15 | 92 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 3.62E-11 | 16 | 61 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 4.0E-10 | 65 | 92 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 7.725 | 66 | 96 | IPR017930 | Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 96 aa Download sequence Send to blast |
MGRTPCCDKK GLKKGPWTPE EDEILVEYIK RNGHGSWRSL PKLAGLLRCG KSCRLRWTNY 60 LRPDIKRGPF TDEEEKLVIQ LHGILGNRFS SICYLA |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 5e-20 | 12 | 95 | 5 | 87 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that may play a role in flower development by repressing ANT (PubMed:19232308). Regulates the transition of meristem identity from vegetative growth to flowering. Acts downstream of LFY and upstream of AP1. Directly activates AP1 to promote floral fate. Together with LFY and AP1 may constitute a regulatory network that contributes to an abrupt and robust meristem identity transition (PubMed:21750030). {ECO:0000269|PubMed:19232308, ECO:0000269|PubMed:21750030}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | FR828560 | 4e-37 | FR828560.1 Rosa hybrid cultivar mRNA for putative MYB transcription factor (myb9 gene), cultivar Yellow Island. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006445088.1 | 3e-59 | transcription factor MYB41 | ||||
Refseq | XP_006491064.1 | 3e-59 | transcription factor MYB41 | ||||
Swissprot | Q9M2D9 | 4e-56 | MYB17_ARATH; Transcription factor MYB17 | ||||
TrEMBL | A0A067H2J7 | 8e-58 | A0A067H2J7_CITSI; Uncharacterized protein | ||||
TrEMBL | A0A2H5NPX2 | 8e-58 | A0A2H5NPX2_CITUN; Uncharacterized protein | ||||
TrEMBL | V4TDD2 | 8e-58 | V4TDD2_9ROSI; Uncharacterized protein | ||||
STRING | XP_006491064.1 | 1e-58 | (Citrus sinensis) | ||||
STRING | XP_006445088.1 | 1e-58 | (Citrus clementina) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G61250.1 | 2e-58 | myb domain protein 17 |