PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Neem_3678_f_1

Organism

Azadirachta indica

Taxonomic ID

124943

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta

Family

DBB

Protein Properties

Length: 238aa MW: 26490.1 Da PI: 4.7726

Description

DBB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Neem_3678_f_1	genome	NGD	View Nucleic Acid

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	zf-B_box	21.3	5.5e-07	4	44	5	39
zf-B_box 5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htv 39 C+ +e+ +++ C ++ lC++C e H H++ Neem_3678_f_1 4 QCDVCERAPATVICCADEAALCAKCDIEVHAAnklaskHQR 44 7*****************************65667777765 PP
2	zf-B_box	27.3	7.6e-09	53	86	2	35
zf-B_box 2 eerkCpeHeekelqlfCedCqqllCedClleeHk 35 + + C+ ++ek + +fC +++ l+C+dC + +H+ Neem_3678_f_1 53 KLPPCDICQEKTAFIFCVEDRALFCKDCDEPIHS 86 6789****************************94 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50119	9.3	1	47	IPR000315	B-box-type zinc finger
CDD	cd00021	2.01E-6	3	47	No hit	No description
Pfam	PF00643	2.8E-5	4	44	IPR000315	B-box-type zinc finger
SMART	SM00336	1.5E-9	4	47	IPR000315	B-box-type zinc finger
SMART	SM00336	1.7E-14	52	99	IPR000315	B-box-type zinc finger
PROSITE profile	PS50119	8.973	52	99	IPR000315	B-box-type zinc finger
Pfam	PF00643	2.2E-7	53	95	IPR000315	B-box-type zinc finger
CDD	cd00021	4.39E-7	55	98	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009651	Biological Process	response to salt stress
GO:0010100	Biological Process	negative regulation of photomorphogenesis
GO:0048573	Biological Process	photoperiodism, flowering
GO:0080167	Biological Process	response to karrikin
GO:0090351	Biological Process	seedling development
GO:1902448	Biological Process	positive regulation of shade avoidance
GO:0005634	Cellular Component	nucleus
GO:0003712	Molecular Function	transcription cofactor activity
GO:0008270	Molecular Function	zinc ion binding

Sequence ? help Back to Top
Protein Sequence Length: 238 aa Download sequence Send to blast
MKIQCDVCER APATVICCAD EAALCAKCDI EVHAANKLAS KHQRLLLQCL SNKLPPCDIC 60 QEKTAFIFCV EDRALFCKDC DEPIHSPGSL SANHQRFLAT GIRVALSSSC SKDAQRSRFE 120 PPPNQRVQQT PVKTPAQQSL SISSPWAMDD LLQFSDFESS DKKEQLEFGE LEWLADMGIF 180 SDQLPQEALA AAEVPQLPVS QSSNITSHRM PKFNMPQKKP RIEMPDDDDE HFTVPDLG

Functional Description ? help Back to Top
Source	Description
UniProt	Acts as negative regulator of seedling photomorphogenesis and light-regulated inhibition of hypocotyl elongation (PubMed:17605755, PubMed:18540109, PubMed:21685177). BBX24/STO and BBX25/STH function as transcriptional corepressors of HY5 activity, leading to the down-regulation of BBX22 expression. BBX24/STO acts additively with BBX25/STH during de-etiolation and the hypocotyl shade avoidance response (PubMed:23624715). Functions as negative regulator of photomorphogenic UV-B responses by interacting with both COP1 and HY5 (PubMed:22410790). May act as a transcription factor in the salt-stress response (PubMed:12909688). {ECO:0000269\|PubMed:12909688, ECO:0000269\|PubMed:17605755, ECO:0000269\|PubMed:18540109, ECO:0000269\|PubMed:21685177, ECO:0000269\|PubMed:22410790, ECO:0000269\|PubMed:23624715}.
UniProt	Acts as negative regulator of seedling photomorphogenesis (PubMed:18540109). BBX25/STH and BBX24/STO function as transcriptional corepressors of HY5 activity, leading to the down-regulation of BBX22 expression. BBX25/STH acts additively with BBX24/STO during de-etiolation and the hypocotyl shade avoidance response (PubMed:23624715). {ECO:0000269\|PubMed:18540109, ECO:0000269\|PubMed:23624715}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Circadian regulation with a peak before dawn. {ECO:0000269\|PubMed:17605755}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_024044545.1	1e-150	B-box zinc finger protein 25
Refseq	XP_024954583.1	1e-150	B-box zinc finger protein 25-like
Swissprot	Q96288	1e-100	BBX24_ARATH; B-box zinc finger protein 24
Swissprot	Q9SID1	1e-100	BBX25_ARATH; B-box zinc finger protein 25
TrEMBL	A0A067DTY9	1e-149	A0A067DTY9_CITSI; Uncharacterized protein
STRING	XP_006478724.1	1e-150	(Citrus sinensis)
STRING	XP_006442999.1	1e-150	(Citrus clementina)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM2711	27	67

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G31380.1	1e-102	salt tolerance homologue

Publications ? help Back to Top
Gangappa SN,Holm M,Botto JF Molecular interactions of BBX24 and BBX25 with HYH, HY5 HOMOLOG, to modulate Arabidopsis seedling development. Plant Signal Behav, 2014. [PMID:23733077] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Imtiaz M, et al. Identification and functional characterization of the BBX24 promoter and gene from chrysanthemum in Arabidopsis. Plant Mol. Biol., 2015. 89(1-2): p. 1-19 [PMID:26253592] Zhang X,Lin R Light signaling differentially regulates the expression of group IV of the B-box zinc finger family. Plant Signal Behav, 2017. 12(9): p. e1365213 [PMID:28922622] Job N,Yadukrishnan P,Bursch K,Datta S,Johansson H Two B-Box Proteins Regulate Photomorphogenesis by Oppositely Modulating HY5 through their Diverse C-Terminal Domains. Plant Physiol., 2018. 176(4): p. 2963-2976 [PMID:29439209]