PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Neem_36116_a_1

Organism

Azadirachta indica

Taxonomic ID

124943

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta

Family

NAC

Protein Properties

Length: 80aa MW: 9336.8 Da PI: 6.7875

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Neem_36116_a_1	genome	NGD	View Nucleic Acid

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	61.8	2.1e-19	14	60	2	49
NAM 2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk 49 ppGfrFhP+deel+v+yL++k++++++++ +vi+evdiyk++Pw+Lp+ Neem_36116_a_1 14 PPGFRFHPSDEELIVHYLQNKAASRPVPA-SVIAEVDIYKYNPWELPS 60 9*************************9.99************94 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	3.4E-21	10	62	IPR003441	NAC domain
PROSITE profile	PS51005	21.307	13	80	IPR003441	NAC domain
Pfam	PF02365	2.9E-8	14	56	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 80 aa Download sequence Send to blast
MEIRENNPLR FQFPPGFRFH PSDEELIVHY LQNKAASRPV PASVIAEVDI YKYNPWELPS 60 VCFTSLSLVI MHGYSILFLR

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3ulx_A	1e-16	11	60	13	62	Stress-induced transcription factor NAC1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor of the NAC family associated with the grain protein content (GPC). Accelerates senescence and increases nutrient remobilization from leaves to developing grains. Sequences of 11 European varieties of H.vulgare tested belongs to the same haplotype while the sequence found in H.spontaneum, an ancestor of the cultivated H.vulgare which has a higher GPC, belongs to an other haplotype. {ECO:0000269\|PubMed:17124321, ECO:0000269\|PubMed:20005003}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_021278986.1	1e-25	NAC domain-containing protein 19-like
Refseq	XP_021681110.1	9e-26	NAC domain-containing protein 68-like
Swissprot	A0SPJ8	5e-21	NAM1_HORVV; NAC transcription factor NAM-1
TrEMBL	A0A1R3KR12	1e-23	A0A1R3KR12_9ROSI; No apical meristem (NAM) protein
TrEMBL	A0A218XHG9	6e-24	A0A218XHG9_PUNGR; Uncharacterized protein
STRING	EOY33050	3e-24	(Theobroma cacao)
STRING	evm.model.supercontig_435.1	1e-24	(Carica papaya)
STRING	XP_010043727.1	5e-26	(Eucalyptus grandis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM7967	13	40

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G61110.1	3e-23	NAC domain containing protein 25

Publications ? help Back to Top
Uauy C,Distelfeld A,Fahima T,Blechl A,Dubcovsky J A NAC Gene regulating senescence improves grain protein, zinc, and iron content in wheat. Science, 2006. 314(5803): p. 1298-301 [PMID:17124321] Jamar C, et al. NAM-1gene polymorphism and grain protein content in Hordeum. J. Plant Physiol., 2010. 167(6): p. 497-501 [PMID:20005003]