PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Neem_29976_a_1

Organism

Azadirachta indica

Taxonomic ID

124943

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta

Family

HSF

Protein Properties

Length: 94aa MW: 10925.4 Da PI: 5.0212

Description

HSF family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Neem_29976_a_1	genome	NGD	View Nucleic Acid

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	HSF_DNA-bind	83.5	3.1e-26	25	84	2	61
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTT CS HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYg 61 Fl+k+y++++d+++++++sw e+ ++fvv+ + efa+++Lp+yFkh+nf+SFvRQLn+Y+ Neem_29976_a_1 25 FLTKTYQLVDDPTTDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSSFVRQLNTYE 84 9**********************************************************6 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.10	3.0E-28	17	84	IPR011991	Winged helix-turn-helix DNA-binding domain
SMART	SM00415	4.0E-24	21	93	IPR000232	Heat shock factor (HSF)-type, DNA-binding
SuperFamily	SSF46785	5.44E-24	22	84	IPR011991	Winged helix-turn-helix DNA-binding domain
PRINTS	PR00056	2.2E-15	25	48	IPR000232	Heat shock factor (HSF)-type, DNA-binding
Pfam	PF00447	4.1E-22	25	84	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PRINTS	PR00056	2.2E-15	63	75	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PRINTS	PR00056	2.2E-15	76	88	IPR000232	Heat shock factor (HSF)-type, DNA-binding

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 94 aa Download sequence Send to blast
MALMLDNCEG ILLSLDSHKS VPAPFLTKTY QLVDDPTTDH IVSWGEDDTT FVVWRPPEFA 60 RDLLPNYFKH NNFSSFVRQL NTYEDCTRQM GVRK

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5d5u_B	8e-17	20	83	25	87	Heat shock factor protein 1
5d5v_B	8e-17	20	83	25	87	Heat shock factor protein 1
5d5v_D	8e-17	20	83	25	87	Heat shock factor protein 1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator that specifically binds DNA of heat shock promoter elements (HSE). {ECO:0000269\|PubMed:16202242}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_012068333.1	1e-54	heat stress transcription factor B-4
Refseq	XP_022940704.1	2e-55	heat stress transcription factor B-4-like, partial
Swissprot	Q7XHZ0	7e-42	HFB4B_ORYSJ; Heat stress transcription factor B-4b
TrEMBL	A0A151RI74	8e-54	A0A151RI74_CAJCA; Heat stress transcription factor B-4
STRING	evm.model.supercontig_49.32	1e-54	(Carica papaya)
STRING	cassava4.1_010510m	5e-54	(Manihot esculenta)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM965	28	111

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G46264.1	4e-43	heat shock transcription factor B4

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764]