PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Neem_29202_f_1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
|
||||||||
Family | BES1 | ||||||||
Protein Properties | Length: 103aa MW: 11856.6 Da PI: 10.1927 | ||||||||
Description | BES1 family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF822 | 164.7 | 5.5e-51 | 3 | 78 | 1 | 76 |
DUF822 1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpl 76 g+sgr ptwkErEnnkrRERrRRaiaakiyaGLRaqGn+klpk++DnneVlkALc+eAGwvve+DGttyrk ++ + Neem_29202_f_1 3 GSSGRLPTWKERENNKRRERRRRAIAAKIYAGLRAQGNFKLPKHCDNNEVLKALCAEAGWVVEEDGTTYRKICRFH 78 689********************************************************************99865 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF05687 | 1.2E-46 | 4 | 76 | IPR008540 | BES1/BZR1 plant transcription factor, N-terminal |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 103 aa Download sequence Send to blast |
MTGSSGRLPT WKERENNKRR ERRRRAIAAK IYAGLRAQGN FKLPKHCDNN EVLKALCAEA 60 GWVVEEDGTT YRKICRFHCN IGNGFHDSRS FDFLVIVLLG YNL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5zd4_A | 3e-27 | 7 | 76 | 372 | 441 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
5zd4_B | 3e-27 | 7 | 76 | 372 | 441 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
5zd4_C | 3e-27 | 7 | 76 | 372 | 441 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
5zd4_D | 3e-27 | 7 | 76 | 372 | 441 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | May function in brassinosteroid signaling. {ECO:0000250}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009352718.1 | 9e-38 | PREDICTED: BES1/BZR1 homolog protein 4-like | ||||
Swissprot | Q6EUF1 | 1e-28 | BZR4_ORYSJ; Protein BZR1 homolog 4 | ||||
TrEMBL | A0A444FK93 | 8e-35 | A0A444FK93_ENSVE; Uncharacterized protein | ||||
STRING | XP_009352718.1 | 4e-37 | (Pyrus x bretschneideri) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM15511 | 11 | 17 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G50750.1 | 2e-25 | BES1/BZR1 homolog 1 |